KEGG   Methylobacterium sp. 4-46: M446_3572Help
Entry
M446_3572         CDS       T00679                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00030  Pentose phosphate pathway
met00710  Carbon fixation in photosynthetic organisms
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M446_3572
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_3572
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     M446_3572
    4.1.2.22  fructose-6-phosphate phosphoketolase
     M446_3572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACA17953
JGI: M4463572
UniProt: B0UAN8
Position
3988668..3991166
Genome map
AA seq 832 aa AA seqDB search
MTGTAGTTRATASVRGRDGSVPGPLAPHDLAGLDAYWRAANYLSVGQIYLMENPLLREPL
TPAQVKPRLLGHWGTTPGLNFIYAHLNRVIRARDLDMIAVWGPGHGAPGLVANAYLEGTY
SEIYPDVAQDEAGMARLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLVHAFGAALDNP
DLIVACVVGDGEAETGALAASWHSAKFLDPRHDGTVLPILHLNGYKIANPTILARMPEAE
LRSLLVGYGYDPIMVAGDEPAPMHQAMAAALDDALDRIARIRHEAAAERPRWPMIVLRSP
KGWTGPAQVDGKPVEGTWRAHQVPVAAIRDNPEHLAILDAWLRSYAPETLFDAAGRLRPD
LAALAPRGERRLSANPQANGGRHPKPLRRPPLAQHAIPVPAPGATEAEATRVLGGYLRDL
LSLNAEARNLRIMGPDETASNRLDAVFGVTDRAWQERILPGDEHLGRFGRVMEVLSEQLC
EGWLEGYLLTGRHGLFASYEAFIHVVDSMVNQHAKWLKSARALPWRRPVPSLNLLLSSHV
WRQDHNGFSHQDPGFIDFIANKRGDTARVYLPPDANTLLWVADHCLGTHDRINVIVAGKQ
PAPQWFSPEAAARHCEAGLGVLDFASTEGQGEPDVVMACAGDVPTMETLAAVDALRRAVP
DLAIRVVNVVDLMTLASPDAHEHGIDDAAFDGIFTRDRPVIFAYHGYPWLIHRLTYKRTN
HANFHVHGFIEEGTTTTPFDMAVMNRLDRHHLAIAALRRVPRLGARAGRVERALRERLAI
HREHVCRTGEDLPEIRDWRWGEGEWPPAASADPSREEDADPRDLEAGWQFMS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaacggcgggaacgacgcgggcgacggcttcggtgcggggcagggacgggtcc
gtgcccgggcccctcgccccgcacgacctcgccggcctcgacgcctactggagggcggcg
aactacctctcggtcgggcagatctacctgatggagaacccgctgctgcgcgagccgctg
acgcccgcgcaggtgaagccgcggctcctcggccactggggcaccacgccggggctgaac
ttcatctacgcccacctgaaccgggtgatccgcgcgcgcgacctcgacatgatcgcggtc
tggggcccgggccacggcgcgccggggctggtggccaacgcctacctggagggcacctac
agcgagatctacccggacgtcgcccaggacgaggccgggatggcccgcctgttccggcaa
ttctccttcccgggcgggatcccgagccacgcctcgccggagctgcccggctcgatccac
gagggcggcgagctcggctactccctcgtccacgccttcggggccgccctcgacaatccc
gacctgatcgtcgcctgcgtggtgggcgacggcgaggccgagaccggggcgctcgccgcc
tcctggcactcggcgaagttcctcgacccgcgccacgacggcaccgtcctgccgatcctc
cacctcaacggctacaagatcgccaacccgaccatcctcgcccgcatgcccgaggcggag
ctgaggagcctcctcgtcggctacggctacgacccgatcatggtggcgggcgacgagccc
gccccgatgcaccaggccatggcggcggccctcgacgacgccctcgaccgcatcgcgcgg
atccggcacgaggccgcggcggagcgcccgcgctggcccatgatcgtgctgaggagcccg
aagggctggaccggcccggcgcaggtcgacggcaagcccgtggaggggacctggcgcgcc
caccaagtcccggtggcggcgatccgcgacaaccccgagcacctcgcgatcctcgacgcg
tggctgcgctcctacgcgccggagacgctgttcgacgcggccgggcgcctgcggcccgac
ctcgccgccctggcgccgcgcggcgagcggcggctctcggccaacccgcaggccaatggc
gggcgccaccccaagcccctgcgccggccgcccctcgcgcagcacgcgatcccagtcccg
gcgccgggcgccacggaggcggaggcgacgcgggtgctcggcggctacttgcgcgacctc
ctctccctcaacgccgaggcccgcaacctgcgcatcatggggccggacgagaccgcctcg
aaccgcctcgacgcggtgttcggggtgacggaccgcgcctggcaggagcggatcctgccc
ggcgacgagcatctcggccgcttcgggcgggtgatggaggtgctgagcgagcagctctgc
gagggctggctcgaaggctacctgctcaccggccgccacggcctgttcgcgagctacgag
gccttcatccacgtcgtcgactcgatggtgaaccagcacgccaagtggctgaaatcggcc
cgggcgctgccctggcggcggccggtgccgtcgctcaacctgctgctctcgtcccacgtc
tggcgccaggaccacaacggattcagccaccaggacccgggcttcatcgacttcatcgcc
aacaagcggggcgacaccgcgcgggtctacctgccgccggacgccaacaccctgctgtgg
gtggcggatcactgtctgggcacgcacgaccgcatcaacgtcatcgtggccggcaagcag
ccggcgccgcaatggttctcccccgaggcggcggcgcgccactgcgaggccgggctcggc
gtcctcgacttcgcctcgacggaggggcagggggagccggacgtggtgatggcctgcgcc
ggggacgtgcccacgatggagacgctcgcggcggtggacgcgctccgccgcgcggtgccc
gacctcgccatccgcgtcgtcaacgtcgtcgacctgatgaccctggcctcgcccgacgcg
cacgagcacggcatcgacgacgcggccttcgacgggatcttcacccgggaccggccggtg
atcttcgcctatcacggctatccctggctgatccaccggctcacctacaagcggacgaac
cacgcgaacttccacgtccacggcttcatcgaggaggggacgacgacgacccccttcgac
atggcggtgatgaaccgcctcgaccgccaccacctcgccatcgcggccctgcgccgcgtc
ccgcgcctcggcgcccgggcgggccgggtcgagcgcgccctgcgggagcggctcgccatc
caccgcgagcacgtctgccggaccggggaggatctgcccgagatccgcgactggcgctgg
ggggagggggaatggccgccggccgcctccgcggatccgtcccgcgaggaggatgcggat
ccgcgcgacctcgaggcgggctggcaattcatgagctga

DBGET integrated database retrieval system