KEGG   Methylobacterium sp. 4-46: M446_3572Help
Entry
M446_3572         CDS       T00679                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M446_3572
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_3572
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     M446_3572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3988668..3991166
Genome map
AA seq 832 aa AA seqDB search
MTGTAGTTRATASVRGRDGSVPGPLAPHDLAGLDAYWRAANYLSVGQIYLMENPLLREPL
TPAQVKPRLLGHWGTTPGLNFIYAHLNRVIRARDLDMIAVWGPGHGAPGLVANAYLEGTY
SEIYPDVAQDEAGMARLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLVHAFGAALDNP
DLIVACVVGDGEAETGALAASWHSAKFLDPRHDGTVLPILHLNGYKIANPTILARMPEAE
LRSLLVGYGYDPIMVAGDEPAPMHQAMAAALDDALDRIARIRHEAAAERPRWPMIVLRSP
KGWTGPAQVDGKPVEGTWRAHQVPVAAIRDNPEHLAILDAWLRSYAPETLFDAAGRLRPD
LAALAPRGERRLSANPQANGGRHPKPLRRPPLAQHAIPVPAPGATEAEATRVLGGYLRDL
LSLNAEARNLRIMGPDETASNRLDAVFGVTDRAWQERILPGDEHLGRFGRVMEVLSEQLC
EGWLEGYLLTGRHGLFASYEAFIHVVDSMVNQHAKWLKSARALPWRRPVPSLNLLLSSHV
WRQDHNGFSHQDPGFIDFIANKRGDTARVYLPPDANTLLWVADHCLGTHDRINVIVAGKQ
PAPQWFSPEAAARHCEAGLGVLDFASTEGQGEPDVVMACAGDVPTMETLAAVDALRRAVP
DLAIRVVNVVDLMTLASPDAHEHGIDDAAFDGIFTRDRPVIFAYHGYPWLIHRLTYKRTN
HANFHVHGFIEEGTTTTPFDMAVMNRLDRHHLAIAALRRVPRLGARAGRVERALRERLAI
HREHVCRTGEDLPEIRDWRWGEGEWPPAASADPSREEDADPRDLEAGWQFMS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaacggcgggaacgacgcgggcgacggcttcggtgcggggcagggacgggtcc
gtgcccgggcccctcgccccgcacgacctcgccggcctcgacgcctactggagggcggcg
aactacctctcggtcgggcagatctacctgatggagaacccgctgctgcgcgagccgctg
acgcccgcgcaggtgaagccgcggctcctcggccactggggcaccacgccggggctgaac
ttcatctacgcccacctgaaccgggtgatccgcgcgcgcgacctcgacatgatcgcggtc
tggggcccgggccacggcgcgccggggctggtggccaacgcctacctggagggcacctac
agcgagatctacccggacgtcgcccaggacgaggccgggatggcccgcctgttccggcaa
ttctccttcccgggcgggatcccgagccacgcctcgccggagctgcccggctcgatccac
gagggcggcgagctcggctactccctcgtccacgccttcggggccgccctcgacaatccc
gacctgatcgtcgcctgcgtggtgggcgacggcgaggccgagaccggggcgctcgccgcc
tcctggcactcggcgaagttcctcgacccgcgccacgacggcaccgtcctgccgatcctc
cacctcaacggctacaagatcgccaacccgaccatcctcgcccgcatgcccgaggcggag
ctgaggagcctcctcgtcggctacggctacgacccgatcatggtggcgggcgacgagccc
gccccgatgcaccaggccatggcggcggccctcgacgacgccctcgaccgcatcgcgcgg
atccggcacgaggccgcggcggagcgcccgcgctggcccatgatcgtgctgaggagcccg
aagggctggaccggcccggcgcaggtcgacggcaagcccgtggaggggacctggcgcgcc
caccaagtcccggtggcggcgatccgcgacaaccccgagcacctcgcgatcctcgacgcg
tggctgcgctcctacgcgccggagacgctgttcgacgcggccgggcgcctgcggcccgac
ctcgccgccctggcgccgcgcggcgagcggcggctctcggccaacccgcaggccaatggc
gggcgccaccccaagcccctgcgccggccgcccctcgcgcagcacgcgatcccagtcccg
gcgccgggcgccacggaggcggaggcgacgcgggtgctcggcggctacttgcgcgacctc
ctctccctcaacgccgaggcccgcaacctgcgcatcatggggccggacgagaccgcctcg
aaccgcctcgacgcggtgttcggggtgacggaccgcgcctggcaggagcggatcctgccc
ggcgacgagcatctcggccgcttcgggcgggtgatggaggtgctgagcgagcagctctgc
gagggctggctcgaaggctacctgctcaccggccgccacggcctgttcgcgagctacgag
gccttcatccacgtcgtcgactcgatggtgaaccagcacgccaagtggctgaaatcggcc
cgggcgctgccctggcggcggccggtgccgtcgctcaacctgctgctctcgtcccacgtc
tggcgccaggaccacaacggattcagccaccaggacccgggcttcatcgacttcatcgcc
aacaagcggggcgacaccgcgcgggtctacctgccgccggacgccaacaccctgctgtgg
gtggcggatcactgtctgggcacgcacgaccgcatcaacgtcatcgtggccggcaagcag
ccggcgccgcaatggttctcccccgaggcggcggcgcgccactgcgaggccgggctcggc
gtcctcgacttcgcctcgacggaggggcagggggagccggacgtggtgatggcctgcgcc
ggggacgtgcccacgatggagacgctcgcggcggtggacgcgctccgccgcgcggtgccc
gacctcgccatccgcgtcgtcaacgtcgtcgacctgatgaccctggcctcgcccgacgcg
cacgagcacggcatcgacgacgcggccttcgacgggatcttcacccgggaccggccggtg
atcttcgcctatcacggctatccctggctgatccaccggctcacctacaagcggacgaac
cacgcgaacttccacgtccacggcttcatcgaggaggggacgacgacgacccccttcgac
atggcggtgatgaaccgcctcgaccgccaccacctcgccatcgcggccctgcgccgcgtc
ccgcgcctcggcgcccgggcgggccgggtcgagcgcgccctgcgggagcggctcgccatc
caccgcgagcacgtctgccggaccggggaggatctgcccgagatccgcgactggcgctgg
ggggagggggaatggccgccggccgcctccgcggatccgtcccgcgaggaggatgcggat
ccgcgcgacctcgaggcgggctggcaattcatgagctga

DBGET integrated database retrieval system