KEGG   Methylobacterium sp. 4-46: M446_3652Help
Entry
M446_3652         CDS       T00679                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M446_3652
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M446_3652
   00630 Glyoxylate and dicarboxylate metabolism
    M446_3652
Enzymes [BR:met01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     M446_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4077924..4080128
Genome map
AA seq 734 aa AA seqDB search
MMMDREKVSGLQVARVLHDFVVREALPGTGVSPEVFWGGLAAVLRDLTPRNRALLAKRDA
LQDRIDAWHRERAGRPVDEAAYESFLREIGYLLPDPGPVRARTENVDDEIASIAGPQLVV
PVSNARYALNAANARWGSLYDAFYGTDAISDEGGAVRGPGYNRTRGARVVTRARAFLDRT
VPLAGGRHADVVTYAIEGGALVGNMNTGDTIPLARPEAFVGYRGRASMPSALLLRHNGLH
IEIVLDRTHRIGRFDASGVADILIESAISTIMDLEDSVAAVDADDKVVVYRNWLGLMNGS
LSATFQKDGRVLERRLNPDRHYTAPTGGEVTVPGRSLMLVRNVGHHMFTDAVRDAEGNEV
PEGILDAAVTAMIAIHDLRNESGLRNSRKGSVYIVKPKMHGPEEVAFAVELFGRVEAMLG
LERNTLKMGIMDEERRTTVNLAACIKAADERVVFINTGFLDRTGDEIHTAMEAGPVIRKN
DMKATPWIKGYEENNVDVGLACGLLGRAQIGKGMWAAPDAMADMLMQKGAHPKAGASTAW
VPSPTAATLHALHYHETDVRARQEELARRPRSALHEILQIPLARSNFAPDDVQQEIDNNA
QSILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVSEEQVMETL
RRMAKVVDRQNAGDPLYTPMAPGFDGPAFRAACDLVFKGRVQPNGYTEWVLHARRREAKA
AGAPTEKAREGATA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggatcgagaaaaggtcagcgggttgcaggtggcgcgggtgctccacgacttc
gtggtccgcgaggcattgccgggcacgggcgtgtcgcccgaggtgttctggggcgggctc
gccgccgtcctgcgcgacctgacgccgagaaaccgcgccctgctcgccaagcgcgacgcg
ctgcaggaccggatcgacgcgtggcaccgcgagcgcgcgggcaggcccgtcgacgaggcc
gcctacgagagcttcctgcgcgagatcggctatctcctgcccgatccgggcccggtgcgc
gcccgcaccgagaacgtggacgacgagatcgccagcatcgcgggcccccagctggtggtt
ccggtctcgaatgcccgctacgccctcaacgccgccaatgcccgctggggctcgctctac
gacgcgttctacggcaccgacgcgatctcggacgagggcggcgcggtccgcggcccgggc
tacaaccgcacccgcggcgcccgcgtcgtcacccgcgcccgtgccttcctggaccgcacc
gtgccgctcgcgggcgggcgccacgccgacgtcgtgacctacgccatcgagggcggcgcc
ctcgtcggcaacatgaacaccggcgacaccatcccgctggcgcggcccgaggccttcgtc
ggctatcgcggccgggcgagcatgccctcggcgctgctcctgcgccacaacggcctgcac
atcgagatcgtcctcgaccgcacccaccggatcggccgcttcgacgcctcgggcgtggcc
gacatcctgatcgaatccgcgatctcgaccatcatggacctggaggattccgtcgcggcg
gtcgacgcggacgacaaggtcgtcgtctaccgcaactggctcggcctgatgaacggcagc
ctctcggcgacgttccagaaggacggccgcgtgctggagcgccgcctcaaccccgaccgg
cactacaccgccccgaccggcggcgaggtgacggtgcccggccgcagcctgatgctggtg
cgcaatgtcggccaccacatgttcacggacgcggtgcgcgatgcggagggcaacgaggtg
ccggaaggcatcctcgacgccgccgtcacggcgatgatcgcgatccacgacctgcgcaac
gaatccggcctgcgcaacagccgcaagggctcggtctacatcgtcaagccgaagatgcac
gggcccgaggaggtcgccttcgcggtcgagctgttcggccgggtcgaggcgatgctgggc
ctggagcgcaacacgctcaagatgggcatcatggacgaggagcgccgcaccacggtcaac
ctcgccgcctgcatcaaggccgccgacgagcgggtcgtgttcatcaataccggcttcctc
gaccgcaccggcgacgagatccacaccgcgatggaggcgggaccggtcatccgcaagaac
gacatgaaggcgacgccctggatcaagggctacgaggagaacaacgtcgatgtcgggctg
gcctgcgggctgctcggccgggcgcagatcggcaagggcatgtgggcggcgcccgacgcc
atggccgacatgctgatgcagaagggggcccacccgaaggccggcgccagcacggcctgg
gtcccgtcgccgaccgccgcgacgctccacgccctgcactaccacgagaccgacgtgcgc
gcccgccaggaggagctcgcgcgccggccccgctcggccctgcacgagatcctgcagatc
ccgctcgcccgctccaacttcgcccccgacgacgtccagcaggagatcgacaacaacgcc
cagagcatcctcggctacgtggtgcgctggatcgatcagggcgtcggctgctccaaggtc
ccggacatccacgatgtcgggctgatggaggaccgcgccaccctgcgcatctcctcccag
cacatcgccaactggctgcaccacggcgtggtcagcgaggagcaggtgatggagacgctc
cggcggatggccaaggtcgtggatcgccagaatgccggcgacccgctctacacgccgatg
gcgccgggcttcgacgggccggccttccgggccgcctgcgacctcgtcttcaagggccgc
gtgcagccgaacggctacaccgagtgggtgctgcatgcccgccgccgcgaggcgaaggcg
gccggagccccgaccgagaaggcccgcgagggcgccacggcgtga

DBGET integrated database retrieval system