KEGG   Methylobacterium sp. 4-46: M446_3732Help
Entry
M446_3732         CDS       T00679                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M446_3732 (bchD)
Enzymes [BR:met01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     M446_3732 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4162479..4164224
Genome map
AA seq 581 aa AA seqDB search
MSAAAETWARACLAAALFARDPAGLGGVRLRARPGPVREAWLARLRALLPAGRPVTRLPA
GIADDALLGGLDLAATLRAGRPVVEPGLLARSHGGVVVVPMAERLDAGIAARLARVLETG
AVDLARDGVAARLPAACGLVLLDEGDGEDEAVPSALLERAAFHLDLDGLTLRDVSEPAPP
DSAPVSGETAAAPVEARAAERLCALAAQLGIASLRAPIQALRAARQNAGREGRSALAEPD
LAAAAALVLAPRATRWPAEAEAEPPPPEAPPEEAEGASDPGGGEAAEDRLLAAVAAALPA
GLLARLTDAGAPGAAPGRAGGEARQARSGRPVGARPGDPRRGPLALSETLRAAAPWQRLR
RGAEAERLRLAPEDIRVRRFVHRAGTTTIFAVDASGSAALERLAEAKGAVELLLAECYVR
RDRVALVAFRGRGAELLLPPTRALVRAKRALAALPGGGGTPLAAGIEAAALLAAAERRGG
RIPVVLLLTDGRANIGRGGAPGRAQAAADALAAGRALAAGGTRALVIDTAAQPQDGARRL
AEAMAARYLPMPRADAALLSEAVRREAPPRGAAPRGTAPRG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgccgccgagacctgggcccgggcctgcctggcggcggccctgttcgcgcgc
gacccggccgggctcggcggcgtgcggctgcgcgcgcggccgggaccggtgcgggaggcg
tggctcgcgcggctgcgcgccctcctgcccgccggccgcccggtgacgcggctgccggcc
ggcatcgccgacgacgccctcctcggcggcctcgacctcgccgcgaccctgcgggccggg
cgcccggtcgtcgaacccggcctgctcgcccgcagccacggcggggtggtggtcgtgccg
atggccgagcggctcgacgcggggattgcggcccggctcgcccgggtgctggagaccggc
gcggtcgatctcgcgcgcgacggggtcgcggcccggcttcccgccgcctgcggcctcgtc
ctcctcgacgagggcgacggggaggacgaggcggtgccctccgccctgctggagcgcgcc
gccttccacctcgacctcgacgggctcaccctgcgggacgtctccgagcccgccccgccg
gacagcgcgcccgtgtccggggagaccgccgcggcccccgtcgaggcgcgcgcggccgag
cgcctctgcgccctcgcggcgcagctcggcatcgcctccctgcgagcgccgatccaggcc
ctgcgcgcggcgcgccagaatgccgggcgggaggggcgttcggccctggccgagcccgac
ctcgccgccgcggccgccctcgtcctcgcgccgcgcgcgacgcgctggccggccgaggcc
gaggccgagccgcccccgccggaggcgccgcccgaggaggccgagggcgcgtcggacccg
ggcggcggcgaggcggcggaggatcgcctgctcgccgcggtggcggccgccctgccggcg
ggcctcctcgcccggctgaccgacgcgggcgcgccgggcgcggcgcccggccgggccggt
ggcgaggcgcgccaggcccgaagcggccggccggtcggcgcccgcccgggcgatccgcgc
cgcgggcccctcgccctctccgagacgctgcgcgccgccgcgccctggcagcgcctgcgg
cggggcgcggaggcggagcgcctgcgcctcgcgccggaggacatccgcgtccggcgcttc
gtgcaccgggccgggaccaccacgatcttcgcggtcgacgcctcgggctcggcggccctg
gagcgcctcgccgaggccaagggcgcggtcgaattgctgctggccgagtgctacgtgcgg
cgcgatcgggtcgccctggtggccttccgcggtcggggggcggagctgctcctgcctccg
acccgcgccctggtgcgggcgaagcgggcgctcgccgccctgcccgggggcggcggcacg
ccgctcgcggccgggatcgaggcggccgcgctcctcgccgctgcggagcggcggggcggg
cgcatcccggtggtgctgctgctcacggacggccgcgcgaatatcgggcgcggcggcgcg
ccgggccgggcgcaggccgcggcggacgcgctcgctgccgggcgggccctggcggcgggc
ggcacccgcgccctcgtcatcgacacggccgcgcagccgcaggacggcgcccgccgcctc
gccgaggccatggcggcgcgctacctgccgatgccgcgggccgatgccgcgttgctgagc
gaggccgtgcgccgcgaggcgccgccgcgcggggccgcgccgcgcgggaccgcgccgcga
ggctga

DBGET integrated database retrieval system