KEGG   Methylobacterium sp. 4-46: M446_4216Help
Entry
M446_4216         CDS       T00679                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
met  Methylobacterium sp. 4-46
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M446_4216
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M446_4216
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M446_4216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4654568..4655689
Genome map
AA seq 373 aa AA seqDB search
MTPALDQFRRVVLKVGSALLVDRARGRLRHAWLAALAEDIADLHGRGVDVLVVSSGSIAL
GRTVLGFPPGALRLEESQAAAAVGQIALARHWSEALAHHGIVAGQILVTPHDTEERRRYL
NARATTLKLLDMRAVPVVNENDTVATSEIRYGDNDRLAARVATMIGADLLVLFSDIDGLY
TAPPASDPSARHLPVIPRITPEIEAMAGGPASELSRGGMRTKIEAGKIAAGGGTHMLIAD
GRGKNPLRAVAAGARASWFLSASTPTAARKTWIAGSLEPRGSLVIDAGAERALQGGASLL
PVGVARIEGAFARGDAVVIRSLGGAVLGRGLVAYDSDDAARIIGRSSREIEAVLGYPGRA
EMIHRDDMALVGE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccctcgaccagttccgccgcgtcgtcctgaaggtcggctccgccctcctc
gtcgaccgggcgcgcgggcgcctgcggcacgcctggctcgccgccctcgccgaggacatc
gccgacctgcacgggcgcggcgtcgacgtgctggtggtctcctcgggctcgatcgccctc
gggcggaccgtgctgggcttcccgcccggggcgctgcgcctggaggagagccaggccgcg
gccgcggtggggcagatcgcgctcgcccgccactggtcggaggcgctcgcgcatcacggc
atcgtcgccggccagatcctggtgacgccgcacgacaccgaggagcgccgccgctacctc
aacgcccgcgccacgacgctgaagctcctcgacatgcgggcggtcccggtcgtgaacgag
aacgacacggtcgccacctcggagatccgctacggcgacaacgaccggctcgccgcccgc
gtggcgacgatgatcggggcggatctcctggtgctgttctccgacatcgacgggctctac
acggcgccgccggccagcgacccgtccgcgcgccacctcccggtgatcccgcgcatcacc
ccggagatcgaggccatggccggcggaccggcctcggagctgtcgcgcggcggcatgcgc
accaagatcgaggcgggcaagatcgccgccggcggcggcacccacatgctgatcgcggac
gggcgcggcaagaacccgctgcgggcggtggcggcgggcgcgcgggcctcgtggttcctc
tccgcctcgaccccgacggcggcgcgcaagacctggatcgccggctcgctcgaaccccgc
ggcagtttggtgatcgacgcgggcgccgagcgggcgctgcagggcggggcgagcctgctg
ccggtcggcgtcgcccggatcgagggcgccttcgcccgcggcgacgcggtggtgatccgc
tccctgggcggggccgtgctcgggcgcggcctggtggcctatgacagcgacgacgcggcc
cgcatcatcggccggtcgagccgcgagatcgaggcggtcctgggctatcccggccgcgcc
gagatgatccatcgcgacgacatggcgctcgtcggcgagtag

DBGET integrated database retrieval system