KEGG   Methylobacterium sp. 4-46: M446_4235Help
Entry
M446_4235         CDS       T00679                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00300  Lysine biosynthesis
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
met01230  Biosynthesis of amino acids
Module
met_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    M446_4235
Enzymes [BR:met01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     M446_4235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACA18584
JGI: M4464235
UniProt: B0UP37
Position
4673151..4674341
Genome map
AA seq 396 aa AA seqDB search
MPTTPSPLALAQGLIRCPSVTPEEGGALAYLAGLLAAAGFSVERPVFSAPGTPDVENLYA
RIGADGPCLLLAGHTDVVPPGEPALWRHDPFAGVVEGGELHGRGAVDMKGGIACLAAASL
AFLAERGPAFGGSIAFLVTGDEEGPAVNGTVKLLAWARARGERFDHCILAEPTNPDALGD
MIKIGRRGSLTATLTVLGAQGHVAYPHRAENPIPGLIRLAGALLAAPLDEGTAHFDASNL
EFTTIDVGNPASNVIPAQARAVLNIRFNDLWNPASLEAELRRRLDAAAGNAVRYRLDVQP
TNAVAFLTQPDAFVDLVTAAIEAETGRRPALSTTGGTSDARFIKEACPVIEFGLVGQTMH
QVDERVAVADLDRLAAIFRRILDAYFPASPPPAERA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgacaccctcaccgctcgccctcgcccagggcctgatccgctgcccctccgtc
acgcccgaggagggcggcgccctcgcctacctcgccgggctgctggcggcggcgggcttc
tcggtcgagcgcccggtcttctccgcgcccggcacgcccgacgtcgagaacctctacgcc
cgcatcggcgcggacgggccctgcctgctgctggccgggcataccgacgtcgtgccgccc
ggggagcccgccctgtggcgccacgatcccttcgcgggcgtcgtcgagggcggcgagctc
cacggccgcggcgccgtcgacatgaagggcggcatcgcctgcctcgccgccgcgtccctg
gccttcctggccgagcgcgggccggccttcggcggctcgatcgccttcctggtcaccggc
gacgaggaggggccggcggtgaacgggaccgtgaagctcctcgcctgggcgcgggcgcgg
ggcgagcgcttcgaccattgcatcctggccgagccgaccaaccccgacgcgctcggcgac
atgatcaagatcggccggcgcggctccctcaccgccacgctcaccgtgctgggcgcgcag
ggccacgtcgcctatccgcaccgggccgagaacccgatcccgggcctgatccgcctcgcg
ggcgcgctcctcgccgcccccctcgacgagggcacggcgcatttcgacgcctccaacctc
gaattcaccacgatcgacgtcggcaacccggcctcgaacgtcatcccggcgcaggcccgc
gccgtgctcaacatccgcttcaacgacctctggaatccggccagcctcgaggccgagctg
cggcggcgcctcgacgcggcggccgggaacgcggtgcgctaccgcctcgacgtgcagccg
accaacgcggtcgccttcctgacccagcccgacgccttcgtggacctcgtcaccgccgcg
atcgaggccgagaccgggcgccgcccggccctctccaccacggggggaacctcggacgcg
cgcttcatcaaggaggcctgcccggtgatcgagttcggcctcgtcggccagaccatgcac
caggtcgacgagcgcgtcgcggtggcggatctcgatcgcctcgccgccatcttccgccgc
atcctggatgcctattttccggccagcccgccgcccgccgaacgggcttga

DBGET integrated database retrieval system