KEGG   Methylobacterium sp. 4-46: M446_4534Help
Entry
M446_4534         CDS       T00679                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00860  Porphyrin and chlorophyll metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M446_4534
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     M446_4534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACA18875
JGI: M4464534
UniProt: B0UPD4
Position
4989876..4990664
Genome map
AA seq 262 aa AA seqDB search
MGGDVSGSAPRLDRAPLRVWVARPLPAGARTAARVAALGHAPLLAPVLDLAPSHVPPPDG
RFDALILTSANAAPALGPAGLTGLPAFCVGARTAEAARAAGLREIREAGGDAASLVGLIT
GSLPPGAALLHAAGRERKPEPAASLAAAGFPVTTWIAYAARPLPQLPDPVAAALAEARLD
AALHYSRRSAAAALGLARAAGCEAGFARLAHLCLSEDCAAPLVAAGILSHLVAAMPTEDA
LLSGLTPFPSAQAGSRLGRDRC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgacgtgagcggcagcgcgccgaggctggatcgggcgcccctgcgcgtctgg
gtcgcgcggccgctcccggccggtgcgcgcacggccgcgcgggtggccgcgctcggccac
gcgccgctcctcgctccggtcctcgacctcgcgccgagccacgtcccgccgccggacggg
cgcttcgacgccctgatcctcaccagcgccaacgcggcgccggccctcggcccggccggg
ctgaccggccttccggccttctgcgtcggcgcccgcacggccgaggccgcccgggcggcg
ggcctgcgcgagatccgcgaggccgggggcgacgcggcctccctggtgggcctgatcacc
ggatccctgccgcccggcgccgccctgctccacgcggccggccgggagcgcaagcccgag
cccgccgcgagcctcgcggcggccggcttcccggtcacgacctggatcgcctacgcggcc
cggccgctgccgcagctgcccgatccggtcgccgcggccctcgccgaggcgcgcctcgac
gcggccctgcactattcccgccgcagcgccgccgcggctctgggcctcgcccgcgcggcg
gggtgcgaggccggcttcgcccggctggcgcatctgtgcctctcggaggattgcgccgcg
cccctggtcgccgccgggatcctgtcccatctggtcgcggcaatgccgacggaggacgca
ctcctctccggcctaaccccttttccgtccgcgcaagcaggctcgcgcctgggccgtgac
cgatgctaa

DBGET integrated database retrieval system