KEGG   Methylobacterium sp. 4-46: M446_4570Help
Entry
M446_4570         CDS       T00679                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
met  Methylobacterium sp. 4-46
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M446_4570
   00330 Arginine and proline metabolism
    M446_4570
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M446_4570
Enzymes [BR:met01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     M446_4570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5026074..5027003
Genome map
AA seq 309 aa AA seqDB search
MTDLTRVVTEIAEEMRARPDRGEVATYIPELARMDPRAFGMVVIDADGEVAAAGDCDVPF
SIQSISKVFTLTLALGMVGDRLWRRVGREPSGSPFNSIVQLEYERGIPRNPFINAGAIAV
TDVILSRHQPREALGEILRFLQFLAGDAAIAIDESVAASEQRTGYRNMALANFMKAHGVL
DNPVPYLLGVYFHHCAIAMTCRQLAEAGRFLAHSGRHPATGHLVVQPERARRINAVMLTC
GHYDGSGEFAYRVGLPGKSGVGGGILAIAPGRASIAVWSPGLDAAGNSHLGRIALEMLTK
RLGWSIFGQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctgacccgcgtcgtgaccgagatcgccgaggagatgcgcgcccgccccgac
cgcggcgaggtcgccacctacatcccggaactcgcccgcatggacccgcgggccttcggg
atggtggtgatcgatgccgacggcgaggtcgccgccgccggggattgcgacgtgccgttc
tcgatccagagcatctccaaggtcttcaccctcaccctggcgctcgggatggtgggggac
cggctctggcgccgcgtcggccgcgagccgtcggggagccccttcaactcgatcgtccag
ctcgagtacgagcgcggcatcccccgcaaccccttcatcaatgcgggggcgatcgcggtc
accgacgtgatcctgtcgcgccaccagccccgcgaggcgctgggcgagatcctgcgcttc
ctgcaattcctggcgggcgacgccgcgatcgccatcgacgagtcggtggcggcctccgag
cagcgcacgggctaccgcaacatggcgctggcgaatttcatgaaggcgcacggggtgctc
gacaacccggtgccctacctgctcggcgtctacttccaccactgcgccatcgccatgacc
tgccgccagctcgccgaggccggccgcttcctggcgcattccgggcgtcaccccgcgacc
ggccacctcgtggtgcagcccgagcgggcgcggcgcatcaacgccgtcatgctcacctgc
gggcactacgacggctcgggggaattcgcctaccgggtcggcctgcccggcaagagcggg
gtcggcggcggcatcctggcgatcgcgcccggccgggcctcgatcgccgtgtggtcgccg
gggctcgacgcggcgggcaactcgcatctcggccgcatcgcgctcgagatgctgacgaag
cggctcggctggtcgatcttcggccagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system