KEGG   Methylobacterium sp. 4-46: M446_4606Help
Entry
M446_4606         CDS       T00679                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
met  Methylobacterium sp. 4-46
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    M446_4606
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M446_4606
   00650 Butanoate metabolism
    M446_4606
  Lipid metabolism
   00071 Fatty acid degradation
    M446_4606
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M446_4606
   00310 Lysine degradation
    M446_4606
   00360 Phenylalanine metabolism
    M446_4606
   00380 Tryptophan metabolism
    M446_4606
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M446_4606
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M446_4606
   00281 Geraniol degradation
    M446_4606
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M446_4606
   00627 Aminobenzoate degradation
    M446_4606
   00930 Caprolactam degradation
    M446_4606
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M446_4606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5064359..5065132
Genome map
AA seq 257 aa AA seqDB search
MEYENIRVETRGRVALITLHRPAQLNALCGPLVADLNHALDGFDRDDGIGCIILTGSEKA
FAAGADIAEMRDRTHPEFAMADPFGEWDRVGRRRKPIIAAVAGYALGGGCELAMMCDFIL
AAETAKFGQPEIKLGVIPGAGGTQRLTRAVGKAKAMELCLTGRLMDAAEAERSGLVARIV
PAADLLAEAWKTAETIAAMSLPSVMTVKACVDRAFETSLSEGVRYERGVFYGLFATADQK
EGMAAFLEKRNPNFEHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgagaacatccgggtcgagacgcgcgggcgggtcgccctcatcacgctgcac
cggcccgcgcagctcaacgccctctgcgggccgctggtggccgatctcaaccacgccctc
gacggcttcgaccgcgatgacgggatcggctgcatcatcctgaccggctccgagaaggcc
ttcgcggccggcgccgacatcgccgagatgcgcgaccgcacccatccggaattcgccatg
gcggatccgttcggcgagtgggacagggtcggccggcggcgcaagccgatcatcgcggcg
gtggccggctacgccctcggcggcggctgcgaactcgccatgatgtgcgacttcatcctg
gcggccgagaccgcgaagttcggccagccggagatcaagctcggggtcatcccgggagcg
ggcggcacgcagcgcctgacccgggcggtgggcaaggccaaggcgatggagctctgcctg
accgggcgcctgatggacgccgcggaggcggagaggtccggcctcgtcgcccggatcgtg
ccggccgccgacctcctcgccgaggcctggaagaccgccgagaccatcgcggcgatgtcg
ctgccctccgtcatgaccgtgaaggcctgcgtggaccgcgccttcgagacgagcctgagc
gagggcgtgcgctacgagcgcggcgtgttctacggcctcttcgccaccgccgaccagaag
gagggcatggccgccttcctggagaagcgcaaccccaacttcgagcaccgctga

DBGET integrated database retrieval system