KEGG   Methylobacterium sp. 4-46: M446_4631Help
Entry
M446_4631         CDS       T00679                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:met00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:met00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5089748..5090833)
Genome map
AA seq 361 aa AA seqDB search
MREGNGAARRPFGILPDGRTVDEVTLTNGRLTARILAYGAILRGLDVPDRDGAPADVVLG
FPDLAGYLDRPSYFGASVGRYANRIRGGRFSLDGRSYALATNDGPNALHGGVQGFNRRLW
EITAIRGGEGPAATLRYVSPDGEEGYPGTLTVTATYRLEGPDTLSIAYAATTDQPTIVNL
TNHSFFNLAGEGAGRPILDHVLTIPADTYTPVDPTQIPTGEFAPVADTPFDFRAPTAIGS
RIRDGRHTQIRRGRGYDHNFVLGTAPSQAARPAARLEERGSGRVLDLLTNQPGLQLYTGN
FLDGTAIGKSGLAYRQSDGVALEPQLFPDTPNQPVFGSARLDPGATYRCLIAYRFSTLGD
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaggcaatggcgccgcgcgacgcccgttcgggatcctgccggacggcaggacg
gtcgacgaggtgacgctgaccaacggcaggctcacggcgcggatcctcgcctacggggcg
atcctgcgcggcctcgacgtgccggaccgcgacggcgcgccggcggacgtggtgctgggc
tttcccgacctcgccggctacctcgaccggccgagctatttcggcgcgagcgtcgggcgc
tacgccaaccgcatccgcggcggccgcttcagcctcgacgggcggagctacgcgctcgcc
accaacgacggcccgaacgccctgcacggcggcgtgcagggcttcaaccggcgcctctgg
gagatcaccgcgatccgcggcggcgaggggccggccgcgaccctgcgctacgtcagcccg
gacggggaggagggctatcccggcaccctcacggtcacggccacctaccgcctggagggg
cccgatacgctgagcatcgcctacgcggcgacgaccgaccagccgaccatcgtcaacctg
accaatcacagcttcttcaatctggcgggcgagggcgcgggccgccccatcctcgatcat
gtcctgacgatcccggccgacacctacacgccggtcgatccgacgcagatcccgaccggc
gagttcgcgccggtcgccgacacacccttcgacttccgcgcgcccaccgcgatcgggtcg
cgaatccgggacggccgccacactcagatccggcgcgggcgcggctacgaccacaatttc
gtgctcgggaccgcgccgagccaggcggcgcggccggccgcccggctggaggagcgcggc
tcgggccgcgtcctcgacctgctgacgaaccagccgggcctgcaactctacaccggcaac
ttcctggacgggaccgcgatcggcaagtccggcctcgcctaccgccagtcggacggggtc
gccctggaaccgcaactgtttccggacacgccgaaccagccggtcttcggctcggcccgc
ctcgatcccggggcgacctaccgctgcctcatcgcctaccgcttctccaccctcggagat
ccttaa

DBGET integrated database retrieval system