KEGG   Methylobacterium sp. 4-46: M446_4848Help
Entry
M446_4848         CDS       T00679                                 

Definition
diaminopimelate decarboxylase
Orthology
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
met  Methylobacterium sp. 4-46
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M446_4848
  Amino acid metabolism
   00300 Lysine biosynthesis
    M446_4848
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     M446_4848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5325567..5326838
Genome map
AA seq 423 aa AA seqDB search
MHHFTYRDGTLHAEEVDLARLAEAVGTPFYCYASATLERHFRVFAEAFAGDDPLVCFAVK
ANSNQAVLASLARLGAGMDIVSEGELRRALAAGVPGERIVFSGVAKTRAEMAVALDAGIL
CFNVESEPELEALSEVARARGQTAPVSIRVNPDVDARTHAKISTGKSENKFGIPISRARE
VYARAAALPGLAVAGVDMHIGSQITDLAPYDNAASLLAELARDLMAAGHRLHHIDFGGGL
GIPYRDDNAPPPDPAAFAAVIRPHFRPLGLRPVFEIGRMIAGNAGILVTRVVYVKEGEGR
SFVIVDAGMNDLIRPTLYEAYHALRPVRQPDPEAPRLTADVVGPVCESGDYLALGREMPA
VAPGDLLAVMSAGAYGAVQAGTYNTRRLVPEVLVRGAAHAVVRPRQSYEELIGLDRVPDW
LAP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacttcacctaccgggacggcacgctccacgccgaggaggtcgacctcgcgcgg
ctcgccgaggccgtcggcaccccgttctactgctacgcctccgccaccctggagcggcat
ttccgcgtcttcgccgaggccttcgcgggcgacgatcccctcgtctgcttcgccgtgaag
gcgaattcgaaccaggcggtgctcgccagcctggcccggctcggcgccggcatggacatc
gtgtcggagggcgagctgcgccgcgccctcgcggcgggcgtgccgggcgagcggatcgtg
ttctcgggcgtggccaagacccgcgccgagatggcggtcgcgctcgacgccggcatcctg
tgcttcaacgtcgagagcgagccggaactcgaagccctctcggaggtggcgcgggcgcgc
gggcagactgccccggtctcgatccgcgtcaatcccgacgtcgatgcccggacccacgcc
aagatctcgacgggcaagtccgagaacaagttcggcatcccgatcagccgcgcccgcgag
gtctatgcccgcgcggcggcgctgccggggctcgcggtcgcgggcgtcgacatgcatatc
ggcagccagatcacggatctcgccccctacgacaacgcggcttccctgctcgccgaactc
gcccgcgacctgatggcggcggggcaccggctccaccacatcgatttcggcggcggcctc
ggcatcccctaccgggacgacaacgcgccgccgccggacccggcggccttcgcggcggtg
atccgcccgcacttccggccgctggggctgcggccggtcttcgagatcggccggatgatc
gccggcaatgccggcatcctcgtcacccgggtcgtgtacgtgaaggagggcgagggccgc
agcttcgtgatcgtggatgcggggatgaacgacctgatccgcccgaccctctacgaggcc
tatcacgcgctgcgcccggtgcggcagccggacccggaggcgccgcgcctcaccgcggac
gtggtggggccggtctgcgagagcggggattacctcgcgctcggccgcgagatgccggcg
gtggcgcccggcgacctcctcgcggtgatgagcgcgggcgcctacggggcggtgcaggcc
ggcacctacaacacgcgccgcctggtgccggaggtgctggtgcgcggcgccgcccacgcg
gtggtgcgcccgcgccagagctacgaggagctgatcggtctcgaccgcgtgcccgactgg
ctggcgccctga

DBGET integrated database retrieval system