KEGG   Methylobacterium sp. 4-46: M446_5187Help
Entry
M446_5187         CDS       T00679                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_5187
   00030 Pentose phosphate pathway
    M446_5187
   00051 Fructose and mannose metabolism
    M446_5187
   00052 Galactose metabolism
    M446_5187
   00500 Starch and sucrose metabolism
    M446_5187
   00520 Amino sugar and nucleotide sugar metabolism
    M446_5187
  Nucleotide metabolism
   00230 Purine metabolism
    M446_5187
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M446_5187
Enzymes [BR:met01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     M446_5187
    5.4.2.8  phosphomannomutase
     M446_5187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5710241..5711746)
Genome map
AA seq 501 aa AA seqDB search
MTFPKPHASLAPNSFAFESLPLVAPTGFREYDARWLFPKDLNLMGVQALGLGLGTLIHEM
GVRPDIVTGHDFRAYSASIKLALIAGMMAGGLRVKDIGLALSPMAYFGQFALDCPCVAMV
TASHNDNGWTGVKMGAERPMTFGPAEMGRLKEIVLAGAFKYRDGGAYAFVPDFAARYQAD
LLSRTKTIGRKLKVVAACGNGTAGAFAPAVLEALGCEVVPLDTEADATFPRYNPNPEDMA
MLHAIADTVRETGADVGLGFDGDGDRCGVVDNEGHEIFADKVGVLLARDLSQLHPGATFV
VDVKSTGLFASDPELRARDVKADYWKTGHSYIKRRVNELGALAGFEKSGHFFFNAPIGRG
YDDGLMTAITVIEMLDRNPGRSLADLYRALPKTWGSPTMSPHCADEVKYGVVEKVTARVR
AMMERGEPIGGARITDLVTVNGVRVVTEDGTWGLVRASSNKPELVVVVESPVSEARLRAM
FEGVDGVLRENPEVGAYNQTI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttccgaagccgcatgcatcgctggccccgaacagcttcgcgttcgagtcgctt
ccgctcgtggcccccaccggctttcgcgagtacgacgcgcggtggctctttcccaaggac
ctcaacctcatgggggtgcaggcgctggggctgggcctcgggacgctcatccacgagatg
ggcgtgcggcccgacatcgtcaccggccacgatttccgcgcctactcggcctcgatcaag
ctcgccctcatcgccggcatgatggcggggggcttgcgcgtgaaggatatcgggctcgcc
ctctcgcccatggcctatttcgggcagttcgccctcgattgcccctgcgtggccatggtc
acggcctcccacaacgacaatggctggaccggcgtgaagatgggcgccgagcggcccatg
accttcggccccgccgagatgggccgcctgaaggagatcgtgctggcgggcgccttcaag
taccgcgacggcggcgcctacgccttcgtgccggacttcgccgcccgctaccaggccgac
ctgctctcgcggaccaagacgatcggccgcaagctcaaggtcgtggccgcctgcggcaac
ggcacggcgggcgccttcgcgccggcggtgctggaggcgctcggctgcgaggtcgtgccc
ctcgacaccgaggccgacgcgaccttcccgcgctacaaccccaaccccgaggacatggcg
atgctgcacgcgatcgccgacacggtgcgcgagaccggcgccgatgtggggctgggcttc
gacggcgacggcgaccgctgcggggtggtcgacaacgagggccacgagatcttcgccgac
aaggtcggcgtgctgctcgcccgcgacctctcgcaactgcacccgggcgcgaccttcgtc
gtggacgtcaagtcgacgggcctgttcgcctcggatccggagctgcgggcgcgcgacgtc
aaggcggattactggaagaccggccattcctacatcaagcggcgggtgaacgagctgggc
gcgctggccgggttcgagaagtcgggacacttcttcttcaacgcgccgatcggccgcggc
tacgacgacgggctgatgacggcgatcacggtcatcgagatgctggaccgcaatccgggc
cgcagcctcgccgacctgtaccgggcgctgccgaagacctggggctcgccgacgatgtcg
ccgcactgcgccgacgaggtgaagtacggggtggtcgagaaggtgacggcccgggtgcgg
gccatgatggagcgcggcgagccgatcgggggcgcgcgcatcaccgacctcgtgaccgtg
aacggcgtgcgcgtggtgacggaggacggcacctggggcctggtgcgggcctcgtcgaac
aagccggaactcgtcgtcgtggtggagagccccgtctcggaggcgcgcctgcgcgcgatg
ttcgagggcgtcgacggggtgctgcgcgagaatccggaggtcggcgcctacaatcagacc
atctga

DBGET integrated database retrieval system