KEGG   Methylobacterium sp. 4-46: M446_5249Help
Entry
M446_5249         CDS       T00679                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
met  Methylobacterium sp. 4-46
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:met00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5767498..5768337
Genome map
AA seq 279 aa AA seqDB search
MTLLHKTYGKGRVRVMRVHRDGARHEVRELTVQAMLTGGFDPAFTRADNSTTVSTDTVKN
VVNIVARESMTLAPEEFCRAVARRLIDAYAMVETATVTAHETRWSRLAVDGEPHPHAFTL
DGNGTSVAKVTMARGGALTIESGLSGFTFLKTTESGWANYVKDPYTTLSETHDRLAATSM
EASWLWGRPPADYPAANARILDSLLKVFATTYSHSIQDSLYRMGRAALAAVPEIETISMA
CPNKHYLLVDLARFGLDNDNQVFVATDEPHGQIECTVGR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcctgcacaagacctacggcaagggccgcgtccgcgtgatgcgggtgcaccgg
gacggggcgcgccacgaggtgcgcgaactcaccgtccaggccatgctgaccggcggcttc
gacccggccttcacccgggcggacaactcgaccacggtctccaccgacacggtcaagaac
gtcgtgaacatcgtggcccgcgagagcatgaccctggcgccggaggagttctgccgggcg
gtggcccggcgcctgatcgacgcctacgcgatggtcgagaccgcgaccgtcaccgcccac
gagacccgctggtccaggctcgcggtcgacggggagccccacccgcacgccttcaccctg
gacggcaacggcacctccgtcgccaaggtgacgatggcccggggcggcgcgctcaccatc
gaatccggcctctcgggcttcaccttcctgaagaccacggaatcgggctgggccaactac
gtcaaggacccctacacgacgctctccgagacgcacgaccggctcgccgccaccagcatg
gaggcgtcctggctgtggggccgcccgccggcggattacccggccgccaatgcgcggatc
ctggacagcctgctcaaggtcttcgccaccacctacagccacagcatccaggacagcctc
taccggatgggccgggcggcgctggcggcggtgcccgagatcgagacgatcagcatggcc
tgcccgaacaagcattacctgctggtcgacctcgcgcgcttcggcctcgacaacgacaat
caggtcttcgtggcgacggacgagccgcacggccagatcgagtgcacggtgggccgatga

DBGET integrated database retrieval system