KEGG   Methylobacterium sp. 4-46: M446_5262Help
Entry
M446_5262         CDS       T00679                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:met01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:met00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:met00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:met00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5781122..5782414
Genome map
AA seq 430 aa AA seqDB search
MSTRLPVTVPDIGDFADVPIVEILVKPGDRIAVDDRLISLESDKATMEVPSPVAGVVAEL
LVAIGSKVSAGTPILTLDTSGEAPAPAPRESPAAAPAAPRPASPEPPSPPEPPKPPAADP
LPADGAASIHATPAVRAYARELGVPLDAVPATGPAGRVLREDVQAYVRGSLARPPAPPAP
VPVTGIGAGLPAWPQVAYEKFGPVRREPLSRLQQLSGPNLARNWLTIPHVTNFDHADVTE
SEAFRRELNGEPRQPAVKVTMTAFLLKAAAAALRAHPRFNAALDGGDLILRDYVHVGFAA
DTPRGLVVPVVRDCDRKGIVAIAAEMAELAAQARAGTLKAEAMQGGCFSVSSLGGVGGDG
FTPIINAPEVAILGAAPARIEPVWDGALFQPRLILPLTLSWDHRVVDGVAAARFLRHVAE
TLADIRRAIL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccgcctgcccgtcaccgtccccgacatcggcgacttcgccgacgtgcccatc
gtcgagatcctggtgaagcccggcgaccgcatcgccgtggacgaccggctgatcagcctc
gaatccgacaaggccacgatggaggtgccctcgccggtggcgggcgtggtggccgaactc
ctcgtcgcgatcggcagcaaggtctcggccggcacgccgatcctgaccctggacacctcc
ggcgaggcccccgcccccgcgccgcgcgaatcgcccgcggcggcccccgccgcgccgcgc
cccgcttcccccgagccgcccagcccgcccgagccgcccaagccgcccgccgccgacccg
ctgcccgccgacggcgcggcctcgattcacgccaccccggcggtgcgcgcctacgcgcgg
gaactcggcgtgcccctcgacgcggtgccggcgaccggccccgccggccgggtcctgcgc
gaggacgtccaggcctacgtgcgcgggagcctcgcccgcccgccggccccgcccgcgccg
gtcccggttaccggcatcggggccggcctgccggcctggccgcaggtggcctacgagaag
ttcgggccggtgcggcgggagccgctctcgcggctccagcagctctcggggccgaacctc
gcgcgcaactggctcaccatcccgcacgtcaccaatttcgaccacgcggacgtgaccgag
agcgaggccttccggcgcgagctcaacggcgagccccgccagcctgccgtcaaggtcacc
atgacggccttcctgctgaaggcggcggcggcggccctgcgggctcatccccgcttcaac
gccgccctggacggcggcgacctgatcctcagggactacgtccatgtcggcttcgcggcc
gacaccccgcgcggcctcgtcgtgccggtggtgcgcgactgcgaccgcaagggcatcgtc
gccatcgcggccgagatggcggagctcgccgcgcaggcccgcgccggcaccctgaaggcc
gaggcaatgcaggggggctgcttctcggtctcctccctcggcggcgtcggcggggacggg
ttcacgccgatcatcaacgcgcccgaggtcgcgatcctgggggcggcgccggcccggatc
gagccggtctgggacggcgcgctcttccagccccggctgatcctgcccctgacgctgtcc
tgggaccaccgggtggtggacggcgtcgcggcggcccgcttcctgcgccacgtggccgag
accctcgccgacatccgccgggcgatcctgtag

DBGET integrated database retrieval system