KEGG   Methylobacterium sp. 4-46: M446_5336Help
Entry
M446_5336         CDS       T00679                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    M446_5336
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    M446_5336
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     M446_5336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5861843..5863489
Genome map
AA seq 548 aa AA seqDB search
MTATGREVIAGGVAAGMIAATGGADAQVLRPRLRPDLASPTGKKMLALYAAAVQAMQDPA
INYPPQPQSWTFQSYIHAVPANPFDPAFSGGLPSGTPALKTRIDEIYGNPPAGSPAAAWK
EAALKCWGTCTHASPYFATWHRWYMYYFERVCRVMCKDPNFLLPYWNYGSGPNATLQLPP
GFRNQDYPSLMFDDRGVGFSTPQGDGAQNVAMNAGGYMPFSLINYIPALSTKEMFPSDTN
AIPMGPSQPGYAALGMTGRLENAPHDMVHLGVGGWMGNIPSAAGDPIFFVHHCQVDRLYA
SWEALPGSTYNWGDLPMQPSESTWKDQPAWFVDGSGDLVRVRLGDAIDTAKLGYGYDTLV
KPSPVQVAALSPSAAPRPAPAIVEAAMRTKAFAVGAGGATVTFAPEPGAAGVEPRAASPV
ARDGGSATLVLEGVRLRRRPPAPLSVFVNLPKGTAPQLNGPYYVTTLNFFNFDLATGLPI
AHGHGTGHADHAAPARADLRIEVGAILAAQEAKGLWDRGPITVTITTLGADSVGEATYVT
FDGATLTP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaccgggcgtgaggtgatcgcaggcggagtggcggcgggcatgatcgcggcg
acgggcggggcggatgcgcaggtgctgcgcccgcgcctgcgcccggacctggcctcgccg
accggaaagaagatgctcgcgctctacgccgccgccgtgcaggcgatgcaggacccggcg
atcaactacccgccgcagccgcagagctggaccttccagtcctacatccacgccgtgccg
gccaatcccttcgacccggccttttccggagggctcccgtccggcacgcccgcgctgaag
acccgcatcgacgagatctacggcaacccgcccgccggcagcccggccgccgcctggaag
gaggcggcgctgaagtgctggggcacctgcacgcatgcgagcccctatttcgcgacctgg
catcgctggtacatgtactacttcgagcgcgtgtgccgggtgatgtgcaaggatccgaac
ttcctgctgccctactggaattacggttccggtccgaacgcgacgctgcagcttccgccg
gggttccggaaccaggactatccctcgctgatgttcgacgaccgcggggtcggcttctcc
accccgcagggcgacggcgcgcagaacgtcgccatgaacgcgggcggctacatgccgttc
tccctcatcaactacatcccggccctctccaccaaggagatgttcccctccgacaccaat
gcgatccccatgggtccgtcgcagccgggctacgccgcgctcggcatgaccgggcggctc
gagaacgcgccgcacgacatggtgcacctcggcgtgggcgggtggatgggcaacatcccc
tcggcggcgggcgatccgatcttcttcgtccaccattgccaggtcgaccggctctacgcc
tcctgggaggcgctgcccggctcgacctacaattggggcgacctgcccatgcagccgagc
gagtcgacctggaaggatcagccggcctggttcgtggacgggtccggcgacctcgtccgg
gttcgactcggcgacgcgatcgacacggccaagctcggctacggctacgacacgctggtc
aagccgtcgccggtccaggtcgcggcgctctccccgagcgccgcgccgcggcctgccccc
gcgatcgtggaggccgcgatgcgcacgaaggctttcgcggtcggggccggcggcgccacc
gtgaccttcgccccggagccgggcgcggcgggagtcgagccccgcgccgcgagccccgtc
gcgcgcgacggcgggtccgccacgctcgtcctcgaaggcgtgaggctgcggcggcgcccg
ccggcccccctcagcgtcttcgtgaacctgcccaagggcacggcgccgcagctcaacggc
ccctactacgtgaccaccctcaacttcttcaacttcgacctcgccacgggcctgccgatc
gcccacgggcacgggacggggcacgcggaccacgccgccccggcgcgggccgacctgcgc
atcgaggtgggcgcgatcctggcggcccaggaggcgaaggggctctgggaccgcggaccg
atcaccgtgacgatcaccacgctcggcgccgacagcgtgggcgaggcgacctacgtcacc
ttcgacggcgccaccctgacgccctga

DBGET integrated database retrieval system