KEGG   Methylobacterium sp. 4-46: M446_5400Help
Entry
M446_5400         CDS       T00679                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M446_5400
   01230 Biosynthesis of amino acids
    M446_5400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_5400
   00051 Fructose and mannose metabolism
    M446_5400
   00562 Inositol phosphate metabolism
    M446_5400
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_5400
Enzymes [BR:met01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M446_5400
Exosome [BR:met04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M446_5400
  Exosomal proteins of bladder cancer cells
   M446_5400
  Exosomal proteins of melanoma cells
   M446_5400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5934452..5935213
Genome map
AA seq 253 aa AA seqDB search
MAGERPRPLVAGNWKMNGTRASRAVLEAVIAGLSPALASRADVLVCPPATLIGAFAEAAA
GSPVRIGGQDVHAAASGAHTGCISAEMLADLGASHVIVGHSERRADQHETDAEVRAKALG
AHRAGLVAIICVGETRAEREAGRTLEVVRGQLAGSLPEGARAADTVIAYEPVWAIGTGLT
PTPADVAQVHGLIRRDLTERLGAEGQGLRILYGGSVKPSNAAELMAVPNVDGALVGGASL
KAEDFLGIAAAYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgagcgaccgcgtccgcttgtggcggggaactggaagatgaacggcacccgg
gcctcgcgcgcggtcctggaggcggtgatcgccgggctgtcgccggcgctggcctcgcgc
gccgacgtgctggtctgcccgcccgcgacgctgatcggcgccttcgcggaggcggcggcg
ggctcgcccgtgcggatcggcggccaggacgtgcacgcggcggcgagcggcgcccatacg
ggctgcatctcggccgagatgctggcggatctcggcgccagccacgtgatcgtgggccat
tcggagcggcgcgccgaccagcacgagacggatgccgaggtgcgcgccaaggcgctcggc
gcccaccgggcggggctcgtggcgatcatctgcgtcggcgagacccgggcggagcgcgag
gccggccgcaccctcgaggtggtgcgcggccagctcgccggctcgctgccggagggcgcg
cgggccgccgacacggtgatcgcctacgagccggtctgggcgatcggcaccgggctcacg
cccacccctgccgacgtggcgcaggtgcacgggctgatccgccgcgacctcacggagcgg
ctcggggccgaggggcaggggctgcgcatcctctacggcggctcggtgaagccgtcgaac
gccgccgagctgatggcggtgccgaacgtcgacggagcgctggtgggcggcgccagcctc
aaggcggaggatttcctggggatcgcggcggcctacgcctga

DBGET integrated database retrieval system