KEGG   Methylobacterium sp. 4-46: M446_5406Help
Entry
M446_5406         CDS       T00679                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
met  Methylobacterium sp. 4-46
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:met00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:met00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:met03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:met03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:met03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5939967..5940419
Genome map
AA seq 150 aa AA seqDB search
MTEILFYHMQRQPLESVLPNLLEKSLERRWRVVVQAASEERLAALDDHLWTFSEESFLPH
GTDREPDAGTQPVVLTLRDANPNGATIRFLVEGAALPADAGRYERICVLFDGSDQEALLL
AREQWRAAKEAGHSVAYWQQDETGRWQKKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagattctcttctaccacatgcagcgccagcccctcgaatcggtgctgccgaac
ctcctggagaaatccctggagcggcgctggcgcgtcgtcgtgcaggcggcgagcgaggag
cggctggccgccctcgacgaccacctctggaccttctcggaggagagcttcctgccccac
ggcaccgaccgcgaacccgacgccggcacgcagcccgtcgtgctcaccctgcgcgacgcg
aacccgaacggcgccacgatccgcttcctggtcgagggcgccgccctgcccgccgatgcg
ggacgctacgagcgcatctgcgtcctgttcgacggcagcgaccaggaggcgctgctcctg
gcccgcgagcagtggcgcgccgccaaggaggccgggcacagcgtcgcctactggcagcag
gacgagaccggccgctggcagaagaaggcctga

DBGET integrated database retrieval system