KEGG   Methylobacterium sp. 4-46: M446_5406Help
Entry
M446_5406         CDS       T00679                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
met  Methylobacterium sp. 4-46
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M446_5406
   00240 Pyrimidine metabolism
    M446_5406
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    M446_5406
   03430 Mismatch repair
    M446_5406
   03440 Homologous recombination
    M446_5406
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     M446_5406
DNA replication proteins [BR:met03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     M446_5406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5939967..5940419
Genome map
AA seq 150 aa AA seqDB search
MTEILFYHMQRQPLESVLPNLLEKSLERRWRVVVQAASEERLAALDDHLWTFSEESFLPH
GTDREPDAGTQPVVLTLRDANPNGATIRFLVEGAALPADAGRYERICVLFDGSDQEALLL
AREQWRAAKEAGHSVAYWQQDETGRWQKKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagattctcttctaccacatgcagcgccagcccctcgaatcggtgctgccgaac
ctcctggagaaatccctggagcggcgctggcgcgtcgtcgtgcaggcggcgagcgaggag
cggctggccgccctcgacgaccacctctggaccttctcggaggagagcttcctgccccac
ggcaccgaccgcgaacccgacgccggcacgcagcccgtcgtgctcaccctgcgcgacgcg
aacccgaacggcgccacgatccgcttcctggtcgagggcgccgccctgcccgccgatgcg
ggacgctacgagcgcatctgcgtcctgttcgacggcagcgaccaggaggcgctgctcctg
gcccgcgagcagtggcgcgccgccaaggaggccgggcacagcgtcgcctactggcagcag
gacgagaccggccgctggcagaagaaggcctga

DBGET integrated database retrieval system