KEGG   Methylobacterium sp. 4-46: M446_5471Help
Entry
M446_5471         CDS       T00679                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
met  Methylobacterium sp. 4-46
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    M446_5471
Enzymes [BR:met01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     M446_5471
   3.1.2  Thioester hydrolases
    3.1.2.-  
     M446_5471
Lipid biosynthesis proteins [BR:met01004]
 Fatty acid synthase
  Component type
   M446_5471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6003675..6004448
Genome map
AA seq 257 aa AA seqDB search
MSRIDDRADDRAGGRPTDMVGRRRLRQRLGRDHGGLATFPVPRPLLRPLLCLLLCAAMTL
PAAPARAAERALHLVALGDSLTAGYGLPAEAAFPTVLERALKAKGLAVTVENAGVSGDTT
TGGLDRLDWSVPEGTDGVILELGANDMLRGTDPAVAERNLDAIVARLRGRGIPVLLAGMK
AGRNLGPDYVARFDAIYPRLAERYGLVLYPFFLDGVAGNRGLTLADGLHPTARGVERIVA
GILPTVETFAARLGKAP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgcattgacgaccgcgcggacgaccgcgcgggcgggcgcccgaccgatatggtc
ggtcgccgccgcctccgccagcgcctaggccgcgaccatggcggtctcgcgacattcccg
gtcccccgcccgctcctgcgcccgctcctctgcctgctcctctgcgccgcgatgacgctc
cccgccgcccccgcccgcgccgcggagcgcgcgctgcacctcgtcgcgctcggcgacagc
ctcacggccggctacggcctgccggccgaggcggccttcccgaccgttctggagcgcgcc
ctgaaggcgaagggactcgccgtcacggtcgagaatgcgggcgtgtcgggcgacaccacc
acgggcgggctcgaccggctcgactggtcggtgccggagggcaccgacggcgtcatcctc
gaactcggcgccaacgacatgctgcgcggcaccgacccggcggtcgccgagaggaacctc
gacgccatcgtggcgcggctgagggggcggggcatccccgtgctgctcgccggcatgaag
gcggggcgcaatctcggcccggactacgtggcgcggttcgacgcgatctatccgcgcctc
gcggagcgctacgggctcgtcctctacccgttcttcctcgacggggtcgcgggtaatcgc
ggcctgaccctggcggacgggctgcacccgaccgcccggggcgtcgagcgcatcgtcgcc
ggcatcctgcccaccgtcgagaccttcgcggcgcgcctcggcaaggcgccctga

DBGET integrated database retrieval system