KEGG   Methylobacterium sp. 4-46: M446_5475Help
Entry
M446_5475         CDS       T00679                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    M446_5475
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M446_5475
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M446_5475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6006192..6006761
Genome map
AA seq 189 aa AA seqDB search
MSIARREALALLGGLLALPARAAPSPTGLTAASFSFETVDGTVLALAEMEGKPILVVNTA
TACGFAPQLAGLQQLWTRFGPRGLTVIGVPSGDFGRQEPLDGAAIREAMRRSHGVTFPVV
AKTSVTGPGAHPFYRWAAGERPGETPHWNFHKYLVGRDGHVAAAFATAVEPTDPRVITAI
ARELEPQAG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgcccgccgcgaggcgctcgccctgctcggcggcctgctggcgctgccggcc
cgggccgccccttccccgaccggcctgacggccgcctcgttctcgttcgagacggtggac
ggcaccgtcctcgccctggcggagatggaaggcaagccgatcctcgtcgtcaacacggcc
acggcctgcgggttcgcgccgcagctcgccgggctgcagcagctctggacgcgcttcggc
ccgcgcgggctgacggtgatcggcgtgccctcgggggatttcgggcgccaggagcccctg
gacggcgccgcgatccgggaggcgatgcggcgctcccacggcgtgaccttcccggtcgtg
gccaagacctcggtgacgggaccgggggcgcacccgttctaccgctgggccgcgggcgag
cggcccggcgagacgccgcactggaacttccacaagtacctggtggggcgggacggccac
gtggcggcggccttcgcgaccgcggtcgagccgacggacccgcgggtcatcacggcgatc
gcgcgggaactggagccgcaggccgggtga

DBGET integrated database retrieval system