KEGG   Methylobacterium sp. 4-46: M446_5543Help
Entry
M446_5543         CDS       T00679                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
met  Methylobacterium sp. 4-46
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:met00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M446_5543
Enzymes [BR:met01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     M446_5543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6080978..6083212)
Genome map
AA seq 744 aa AA seqDB search
MNQMVRPKQVERSNPVEALAGTVERVTFHSPETGFCVLKVQARGKRDLVPVVGHAPAIGA
GEWITATGIWITDRTHGLQFKADTLKATPPTGAAGIEKYLASGHMRGIGPAMAKRIVATF
GENTFEIIEAEPDRLREVTGIGPWRAAKIVAGWAEQKAVREIMIFLHAHGVGTARAVRIF
KTYGHEAIQVMTEDPYRLARDIRGIGFRTADAIAMKLGMEKNAPPRLRAGVSFALQTAMD
EGHCALPAERLTVLAQKLLEVEPDLIRAAITEELLRGEEVVADTVGEETCVFLKGLHAAE
RSIAERLIARAAGSPPWPEIDIGKARPWVEQKTGKVLSPSQAEAVRLMLASKLSVITGGP
GVGKTSTLDTVLRILIAKGVRVLLAAPTGRAAKRMTEQTGLEAKTIHRLLEIDPKHGGFS
RNEENPLDCDLLVIDETSMVDVPLMNALLKAVPERSGLLLVGDVDQLPSVGPGQVLADVI
ASGRVPVARLTEVFRQAAESRIVVNAHRINAGKMPEPPRAGDEADFYLIEIAEPEEGVAK
LIEVVTRRIPKRFGFDPVRDIQVLTPMNRGVLGARNLNHELQAVLNPSPPAMVERFGWKF
APGDRVMETQNDYDREVFNGDLGSVLRIDDDEGALMVEFDAREVVYPFGELDTLVPAYAT
TIHKSQGSEYPAVVIPITTQHWTMLARNLLYTGVTRGKRLVVLIGQRKAIGMAVRGGAAK
RRYTKLREWLSWPAVEQPERCARA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatggtccggcccaagcaggtcgagaggagcaaccccgtcgaggctctcgcg
ggtacggtcgagcgcgtcaccttccactcgcccgagaccggcttctgcgtgctcaaggtg
caagcgcggggcaagcgcgacctcgtgccggtggttggtcacgcacccgcgatcggcgcg
ggcgagtggatcaccgccaccggcatctggatcaccgaccgcacccacggcctccagttc
aaggccgacaccctgaaggccacgccgcccaccggggctgcaggcatcgagaagtacctc
gcgtcgggccacatgcgcgggatcggccccgctatggccaagcgcatcgtggccaccttc
ggtgagaataccttcgagatcatcgaggccgagcctgaccggcttcgggaggtcaccggc
atcgggccgtggcgggcggccaagatcgtagccggctgggccgagcagaaggccgtgcgt
gagatcatgatcttcctgcacgcccacggcgtcggcacggccagggcagtgcgcatcttc
aagacctacggccatgaggctattcaggtcatgactgaagatccctaccggctcgcgcgc
gacatccgcggcattggcttccgcaccgccgacgcgatcgcgatgaagctcgggatggag
aagaacgcaccgccgcggctccgggcgggcgtctcgttcgcgctccagacggccatggac
gaggggcactgcgccttacccgccgagcgcctgaccgtgctcgcccagaagctgctggag
gtcgaaccggacctgatccgagccgccatcactgaggagcttctgcgcggcgaggaggtg
gtcgccgacacggtcggggaggagacgtgcgtgttcctgaagggcctgcacgcggccgag
cgcagcatcgccgagcgcctgatcgcccgagcggcgggctcgccgccctggcctgagatc
gacatcggcaaagcgcgaccctgggtcgagcagaagaccggcaaggtgctctccccttct
caggctgaagccgtgcgcctgatgctcgcctccaagctctcggtcatcacgggtgggccg
ggcgtggggaagaccagcaccctcgacacggtgctgcgcatcctgatcgccaagggcgtg
cgcgttctcctcgccgctccgaccggccgcgcggccaagcggatgactgagcagacgggc
ctggaggcaaagaccatccaccgcctgctggagatcgaccccaagcacggcggcttctcg
cgcaacgaggagaacccgctggattgcgacctgctggtgatcgatgagacgtcgatggtg
gacgtgccgctcatgaacgcgttgctgaaggcggtgccggagcgctcagggctgctgctg
gtgggggacgtcgatcagctaccctcggtcgggccggggcaggtgctggcagatgtgatc
gcgtcggggcgcgttccggtggcgcggctcacggaggtgttccgacaggcggccgagagc
cggatcgtcgtcaatgcgcaccggatcaacgcgggcaagatgccggagccgcccagagcg
ggcgacgaggccgacttttacctgatcgagatcgccgagcccgaggagggcgtggcgaag
ctgatcgaggtggtgacccggcgcatcccgaagcggttcggcttcgacccggttcgcgac
attcaggtgctgacgcccatgaaccggggcgtgctgggcgcgcgcaacctgaaccacgaa
ctccaggcggtgctgaacccgagcccgcccgccatggttgagcggttcggctggaagttc
gcgcccggcgaccgagtgatggagacgcagaacgactacgatcgcgaggtgttcaacggc
gacctcggctcggtgctgcgcatcgacgacgatgaaggagcgctgatggtcgagttcgac
gcgcgcgaggtggtctacccgttcggcgaactcgatacgctggtacccgcctacgcgacc
acaatccacaagagccagggctcggagtacccggccgtggtgatcccgatcaccactcag
cactggaccatgctggcgcgcaacctgctctacacgggcgtgacgcgcggcaagcgcttg
gtggtgctgatcgggcagcgaaaggccatcggcatggcggtacgcggtggggcggcgaag
cggcgctacacgaagctgcgcgagtggctctcctggccagccgtcgaacagccggaacgg
tgcgcgcgagcatga

DBGET integrated database retrieval system