KEGG   Methylobacterium sp. 4-46: M446_5834Help
Entry
M446_5834         CDS       T00679                                 

Gene name
alaS
Definition
alanyl-tRNA synthetase
Orthology
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
met  Methylobacterium sp. 4-46
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:met00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6411630..6414290
Genome map
AA seq 886 aa AA seqDB search
MSGVNEIRSTFLDYFAKHGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHR
AATAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKPLAIELAWNLVTKEFGL
DRSKLLVTVYADDDDAATLWRKIAGFPEERIIRIGTSDNFWQMGDTGPCGPCSEIFIDQG
PELWGGPPGSPEEDGDRFLEFWNLVFMQYEQIEPGNRVGLPRPSIDTGMGLERMAAILQG
VKSNYDTDLFRSLIDAVAHQVGRPPEGAQTASYRVIADHLRAASFLVADGVLPGNEGRGY
VLRRIMRRAMRHAQLLGARDPMMYRLVPTLVREMGQAYPELVRAESLISETLRLEETRFR
RTLERGLSILDAETRDLSEGQNLSGETAFTLYDTYGFPLDLTQDALKSRGIGVDTDAFKA
AMERQRAAARAAWAGSGEAATETLWYALRERVGATEFLGYEAETAEGVVTALVRGGVEVE
ALASGEEGLLVVSQTPFYGESGGQVGDTGTVAAAGLRARVTDTEKKLGDLFVHHVAVEEG
RLTVGQAVELRVDHARRAAIRAHHSATHLLHEALRQVLGDHVAQKGSLVSPERLRFDFSH
PKPMNDDEVAAVEEMANRVLLQNGPVVTKLMAVDDAIATGARALFGEKYGDEVRVVSMGE
DQGGDGRRRTFSVELCGGTHVGRTGEIGLITVVGEGAVASGVRRIEAMTGDAARRHLAEE
SRRLAAVAGLLKVPPAEAADRLAALIEDRRRLERELSEARRKLAMGGGGAGEEPVREVAG
VKLMARSVEGVEMRDLKSLADEGKKRLGSGVVAIVGVAPDGKAGLVVGVTDDLTDRFDAV
ALVRAGSERLGGKGGGGRRDMAQAGGPDGAAAQDALAAIEAALAAA
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgtcaacgagatccggtcgaccttcctcgactacttcgccaagcacgggcac
gaggtcgtcccctcctcgccgctcgtaccgcgcaacgaccccacgctgatgttcacgaac
gccggcatggtgcagttcaagaacgtcttcaccggagtcgagaagcggccctaccaccgc
gccgccaccgcccagaagtgcgtccgcgccggcggcaagcacaacgacctcgacaacgtc
gggtacacggcgcgccaccacaccttcttcgagatgctcggcaatttctcgttcggcgac
tacttcaagccgctggcgatcgagttggcctggaacctcgtgacgaaggagttcggcctc
gacaggagcaagctgctggtcacggtctacgccgacgacgacgacgcggcgacgctgtgg
cgcaagatcgccggcttcccggaggagcgcatcatccgcatcggcacctccgacaatttc
tggcagatgggcgataccggcccgtgcgggccgtgctcggagatcttcatcgaccagggt
ccggagctgtggggcggcccgcccggcagcccggaggaggacggcgaccgcttcctcgaa
ttctggaacctcgtcttcatgcagtacgagcagatcgagccgggcaaccgggtcggcctg
ccgcggccctccatcgacaccggcatgggcctggagcgcatggcggcgatcctccagggg
gtgaagagcaactacgacaccgacctgttccggagcctgatcgacgcggtggcccaccag
gtcggccggccgccggagggcgcgcagaccgcctcctaccgggtgatcgccgatcacctg
cgggccgcctccttcctggtcgccgacggggtgctgccgggcaacgaggggcgcggctac
gtgctgcgccggatcatgcggcgggccatgcgccacgcccagctcctcggcgcccgcgac
ccgatgatgtaccgcctcgtgcccaccctggtgcgcgagatggggcaggcctatcccgag
ctggtgcgggccgagtcgctgatctccgagaccctgcgcctggaggagacccgcttccgc
cgcaccctggagcgcggcctgtcgatcctggacgcggagacccgcgacctctccgagggc
cagaacctctcgggcgagaccgccttcacgctctacgacacgtacgggttccccctcgac
ctgacgcaggacgcgctcaagtcgcgcggcatcggcgtcgacaccgacgccttcaaggcc
gcgatggagcgccagcgcgcggcggcccgcgccgcctgggcgggctccggcgaggcggcg
accgagaccctgtggtacgccctgcgcgagcgcgtcggcgccaccgagttcctcggctac
gaggccgagaccgcggagggcgtggtcaccgccctggtccggggcggcgtcgaggtcgag
gcgctggcgtccggcgaggagggcctgctggtggtgagccagacgcccttctacggcgag
tccggcggccaggtcggcgataccggcacggtcgcggcggcggggctgcgggcgcgggtc
accgacaccgagaagaagctcggcgacctcttcgtgcaccacgtcgcggtcgaggagggc
cggctcacggtcgggcaggcggtggagctgagggtcgaccacgcccgccgcgcggcgatc
cgcgcccaccactcggccacccacctgctgcacgaggcgctgcgccaggtgctcggcgac
cacgtcgcccagaagggctccctggtctcgcccgagcgcctgcgcttcgatttcagccac
cccaagccgatgaacgacgacgaggtcgcggcggtcgaggagatggcgaaccgcgtgctg
ctgcagaacgggccggtggtgacgaagctgatggccgtcgacgacgccatcgcgaccggg
gcccgcgcgctcttcggcgagaagtacggcgacgaggtccgggtcgtctcgatgggcgag
gatcagggcggggacgggcgccggcgcaccttctcggtcgagctctgcggcggcacccat
gtgggccgcaccggcgagatcgggctgatcaccgtggtgggggagggcgcggtcgcctcc
ggcgtgcgccggatcgaggcgatgaccggcgacgcggcgcggcgccacctcgccgaggag
agccggcgcctcgccgccgtggcggggctgctgaaggtcccgccggccgaggcggccgac
cgcctcgccgccctgatcgaggacaggcgccggctggagcgggagctctccgaggcgcgc
cgcaagctcgccatgggcggcggcggggcgggcgaggagccggtgcgcgaggtcgcgggc
gtcaagctgatggcccgttccgtcgagggcgtcgagatgcgcgacctcaagagcctcgcg
gacgagggcaagaagcgcctcggctcgggcgtggtcgcgatcgtcggcgtggcgccggac
ggcaaggccggcctcgtcgtcggcgtcaccgacgacctgaccgaccgcttcgacgcggtc
gccctggtgcgggcgggctccgagcgcctcggcggcaagggcggcggcgggcgccgcgac
atggcccaggccggcggcccggacggggcggcggcgcaggacgccctcgccgcgatcgag
gcggcgctcgccgccgcatga

DBGET integrated database retrieval system