KEGG   Methylobacterium sp. 4-46: M446_5835Help
Entry
M446_5835         CDS       T00679                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
met  Methylobacterium sp. 4-46
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:met00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:met00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6414436..6414990
Genome map
AA seq 184 aa AA seqDB search
MRIVDQSIPDVKLVVPARHGDARGWFSETYRADLLAQAGITDLFIQDNQSFSAQVGTVRG
IHFQTHPHAQGKLVRVVSGAILDVAVDLRRASPSYGRHVAVRLDAENGHQLYVPVGFGHA
FCTLEPDTAIAYKVSGGYYSPAHDGALLWNDPDLGIDWPVSPEAAILSAKDKAAPRLADL
PAHF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgtggatcagtccatcccggacgtgaagctcgtcgtcccggcgcgccacggc
gacgcgcgcggctggttctccgagacctaccgggccgacctcctcgcgcaggccggcatc
acggacctcttcatccaggacaaccaatccttctcggcccaggtcggcacggtccggggc
atccacttccagacccatccccacgcgcagggcaagctcgtccgcgtcgtctccggggcg
atcctcgacgtcgccgtggatctgcgccgcgcctcgcccagctacggccgccacgtcgcc
gtgcgcctggatgccgagaacggccaccagctctacgtgccggtcgggttcggccacgcc
ttctgcaccctcgaacccgacaccgccatcgcctacaaggtctcgggcggctactacagc
cccgcccatgacggcgcgctcctctggaacgacccggatctcggcatcgactggccggtc
tcgcccgaggccgcgatcctctccgccaaggacaaggccgccccgcgcctcgccgacctt
cccgcccatttctga

DBGET integrated database retrieval system