KEGG   Methylobacterium sp. 4-46: M446_5837Help
Entry
M446_5837         CDS       T00679                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose reductase
  KO
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
met  Methylobacterium sp. 4-46
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M446_5837
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M446_5837
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     M446_5837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
6416075..6416968
Genome map
AA seq 297 aa AA seqDB search
MRAILILGGGGQVGTALRHAAWPAGVALHAPSREALDVTDEAAVAAALAERAYAAVINAA
AYTAVDRAESEVAAAWRLNALAPAILAAATARAGIPLVQVSTDYVFDGSLAGAYPTDAPV
NPASVYGASKAGGEMAVRTANPRHAVVRTAWVVSPHRANFVKTMLRLAGERDALRVVDDQ
RGCPTSADDLAAALAAIALRLAEDPAAPGGTYHCVNAGATTWCGFARAIMAGARARGARA
VPVEPIATSSYPTPARRPANSELSTATLSRDFGIVPRPWEAALADILDRLIGPVTPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgatcctgatcctcggcgggggcggccaggtcggcacggcgctgcggcacgcc
gcctggccggcgggggtggcgctgcacgcgccgtcgcgcgaggccctcgacgtcaccgac
gaggcggccgtggcggcggcgctcgccgagcgcgcctacgcggcggtgatcaacgccgcc
gcctacacggcggtcgaccgggccgagagcgaggtcgcggcggcgtggcgcctcaacgcg
ctggcgcccgccatcctcgccgccgcgacggcgcgggcggggatcccgctggtgcaggtc
tcgaccgactacgtgttcgacggcagcttggcgggcgcctacccgaccgacgcgcccgtg
aacccggccagcgtctacggggcgagcaaggcggggggcgagatggcggtgcgcacggcc
aatccgcgccacgcggtggtgcgcacggcctgggtggtgagcccgcaccgggccaacttc
gtcaagacgatgctgcggctggcgggcgagcgcgacgcgctgcgggtggtggacgaccag
cgcggctgcccgacctccgccgacgacctcgcggcggcgctcgccgcgatcgccctgcgg
ctcgccgaggatcccgcggccccgggcggcacctaccattgcgtgaatgccggcgcgacg
acctggtgcggcttcgcgcgggcgatcatggcgggcgcccgggcgcgcggggcgcgggcg
gtcccggtcgagccgatcgcgacctcgtcctacccgacgccggcgcggcgcccggccaat
agcgaactctcgaccgcgacgctgagccgggatttcgggatcgtgccgcggccctgggag
gcggcgctcgccgacatcctggaccggctgatcggcccggtgacgccggcctga

DBGET integrated database retrieval system