KEGG   Methylobacterium sp. 4-46: M446_5850Help
Entry
M446_5850         CDS       T00679                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
met  Methylobacterium sp. 4-46
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M446_5850
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M446_5850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6433369..6434334)
Genome map
AA seq 321 aa AA seqDB search
MSDAGGDMGEGASLFVLGSFVAACSATVARLPRPGETLEARAFQFDPGGKGLNLAVGARR
LGARVDGLIAVGHDAFGDLAAAALRRADLPDTLLRRVEAPTGAGIGFVDAAGENCIAVYP
GANARLGAAEVAEVADRLVRARLVLAQFETSDAAVSEAFRRARAAGVETLLNPSPFRPPP
PGLLARTGILVVNATEAAALGEALGLAGAAPADLAAALLDRGPRLVVVTLGRGGAIARAA
GEPLLVQPALPVAALDTIGAGDAFTAGLAVSLAEGHPLAACLRHAAACAACVVARRGVFE
ALPDRAARDAALAALSAPPGP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgcggggggcgacatgggggaaggtgcgagcctgttcgtcctgggcagcttc
gtcgcggcctgttctgccacggttgcgcggcttccgcgacccggggagacgctggaggcc
agggccttccagttcgatccgggcggcaaggggctgaacctcgcggtcggggcgcggcgg
ctgggggcgcgggtcgacgggctgatcgcggtcggccacgacgcgttcggcgacctcgcg
gcggccgccctgcgcagggcggacctcccggacaccctgctgcgccgggtggaggcgccg
accggggcgggaatcggcttcgtggacgcggcgggggagaactgcatcgcggtctatccg
ggggccaatgcgcggctcggggcggcggaggtggcggaggtggccgaccgcttggtccgg
gcgcgcctcgtcctcgcacaattcgagacgagcgatgcggcggtgagcgaggccttccgc
cgcgcgcgggcggccggggtcgagaccctgctcaacccctcgcccttccgcccgccgccg
cccgggctcctcgcccggaccgggatcctggtcgtcaacgccaccgaggcggcggccctc
ggggaggcgctcgggctcgccggcgcggcgcccgcggacctggcggcggccctcctcgac
cgagggccgcgcctcgtcgtggtgacgctcggccgcggcggggcgatcgcccgggcggcg
ggggagccgctcctggtccagcccgccctgccggtcgcggccctcgacacgatcggggcc
ggcgacgccttcacggcggggctcgccgtcagcctcgccgaggggcatccgctcgccgcc
tgcctgcgccacgcggcggcctgcgcggcctgcgtggtcgcccggcgcggcgtgttcgag
gccctgcccgaccgcgcggcccgggacgccgcgctggcggcgctgtccgcgccgccgggc
ccgtga

DBGET integrated database retrieval system