KEGG   Methylobacterium sp. 4-46: M446_5979Help
Entry
M446_5979         CDS       T00679                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
met  Methylobacterium sp. 4-46
Brite
Enzymes [BR:met01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     M446_5979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6567298..6567933
Genome map
AA seq 211 aa AA seqDB search
MDLSPIGRAVLRAREGERLTAYKDSVGVWTIGVGITTASGLIVVRPGLRITRAESDRLFA
QAVERSVDPVRRALAKPVPQEFFDACASLAYNIGPVRFAESTIVRKANAGDLAGAAEAFL
LWNRPAAILPRRRAERDQARTPYARALPRARAGDAAPVRVPAGPPPGPAPRPPDPMAPLT
RPGPARPAPCGGPSAAGRAAPASSGRTLARG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtggacttgtcacccatcggccgcgcggtcctgcgggcgcgcgaaggcgagcggctgacc
gcctacaaggacagcgtgggcgtctggaccatcggcgtcgggatcaccacggcctccggg
ctgatcgtggtcaggcccgggctgcgcatcacgcgagccgagagcgaccggctcttcgcg
caggcggtggagcgctccgtcgacccggtgcgcagggcgctggcgaagccggtgccgcag
gaattcttcgatgcctgcgcgagcctcgcctacaacatcggcccggtgcgcttcgcggaa
tcgaccatcgtccgcaaggccaatgcgggcgacctcgcgggggcggcggaggcgttcctg
ctgtggaaccggccggccgcgatcctgccgcggcggcgggcggagcgcgaccaggcgcgg
acgccctacgcgcgggccctgccgagggcgcgcgccggcgacgcggcgccggtgcgggtg
ccggccgggccgccgcccgggcccgcgccgcggccgcccgacccgatggcgccgctcacc
cgcccgggaccggcccggcccgccccctgcggcgggccttccgctgccggccgggccgca
ccggcgtcctcgggccggacgctcgcgcggggctga

DBGET integrated database retrieval system