KEGG   Methylobacterium sp. 4-46: M446_6033Help
Entry
M446_6033         CDS       T00679                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:met00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:met00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6620375..6621784
Genome map
AA seq 469 aa AA seqDB search
MVAISFLGDLLQSITERGRGLIPFGRGEALSRASVPDLVKLCEDLISRRGEASGVALARI
ILDRYATFTVAERHDFLRRIAVDFGADVEAVAGAIAGYQAAPSRATLGRLHEAAEPRSQE
LIRRLNLARDGTIALVRMREDLFSYRDLLRGAEDRDAALLDAVESLDSDFEHLFASWFNR
GFLVLHRIDWTTPAHILEKIIRYEAVHAISGWDDLRRRIEPADRRCFAFFHPALVDEPLI
FVEVALTTSIATAIGPILSDERQPMASREATAAIFYSISNCQRGLAGVTFGNFLIKQVVE
DLCREMPALKTFVTLSPVPGFRHWLDRERRADAPQGLTREDVETLRLLDRPDWHADKATA
ETVRKALLPAAAYYFLRAKTPRGKPVDPVARFHLGNGARLERLNFLGDVSKKGLAQSYGL
MVNYLYDLAAIEKNHETYANLGTVSASIAVNRELRQNLPPARAVALAEA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatctccttcctcggcgacctcctccagagcatcacggagcgaggccgcggg
ctcatccccttcggccggggggaggctctgtcgcgggcgagcgtccccgacctcgtcaag
ctctgcgaggacctgatctcgcggcggggcgaggcctcgggcgtcgccctcgcccgcatc
atcctcgaccgctacgccaccttcacggtggccgagcgccacgacttcctgcgccggatc
gcggtggatttcggcgccgacgtcgaggcggtggcgggcgccatcgcgggctaccaggcg
gccccctcgcgggcgaccctcgggcggctgcacgaggcggccgagccgcgctcgcaggaa
ttgatccgccgcctcaacctcgcccgcgacggcacgatcgcgctggtgcgcatgcgcgag
gacctgttcagctaccgcgacctcctgcgcggcgccgaggaccgcgacgccgccctgctg
gacgcggtcgagagcctcgattccgacttcgagcacctcttcgcctcctggttcaaccgc
ggcttcctggtgctgcaccggatcgactggaccacgccggcccacatcctggagaagatc
atccgctacgaggcggtgcacgcgatctcgggctgggacgacctgcggcggcggatcgag
ccggcggaccggcgctgcttcgcgttcttccacccggccctggtcgacgagccgctgatc
ttcgtcgaggtggcgctgaccaccagcatcgccacggcgatcggcccgatcctctcggac
gagcgccagcccatggcctcgcgcgaggccacggccgcgatcttctactcgatctcgaac
tgccagcgcgggctcgccggcgtgaccttcggcaatttcctgatcaagcaggtggtggag
gatctctgccgggagatgccggcgctgaagaccttcgtgacgctgtcgccggtgccgggc
ttccgccactggctcgaccgcgagcgccgggcggacgcgccgcagggcctcacgcgcgag
gacgtcgagaccctgcgcctcctcgacaggcccgactggcacgccgacaaggcgaccgcg
gagacggtgcgcaaggcgctgctgccggccgccgcctactacttcctgcgcgccaagacc
ccgcgcggcaagccggtcgacccggtcgcccgcttccatctcggcaacggcgcccggctg
gagcggctgaacttcctcggcgacgtctccaagaagggcctcgcccagtcctacgggctg
atggtgaactacctctacgacctcgcggcgatcgagaagaaccacgagacctacgccaac
ctcggcacggtctcggcctccatcgcggtcaaccgcgaattgcgccagaacctgcccccc
gcccgcgccgtcgcgctggcggaggcctga

DBGET integrated database retrieval system