KEGG   Methylobacterium sp. 4-46: M446_6039Help
Entry
M446_6039         CDS       T00679                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
met  Methylobacterium sp. 4-46
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M446_6039
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M446_6039
   00650 Butanoate metabolism
    M446_6039
  Energy metabolism
   00190 Oxidative phosphorylation
    M446_6039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6626172..6626585
Genome map
AA seq 137 aa AA seqDB search
MVDNRPEATRTIRTSYARVQGLGPAHHGTGEWWLHRVTAVSNVPLILSFVVIVALCAGRS
YEDAVRLVSHPLVAILLILGVLSVTNHMRMGMQIVIEDYVHDKGLKIAAVIANTFYSTVV
AVACLYAIVRISLRAFA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaaccgtcccgaggccacccgcaccatccggacctcctacgcccgggtgcag
gggctcggcccggcccatcacggcaccggcgagtggtggctgcaccgcgtcaccgcggtc
tccaacgtgccgctgatcctgtccttcgtggtgatcgtcgccctctgcgccggccgctcc
tacgaggacgcggtgcgcctggtgtcgcacccgctcgtcgcgatcctgctgatcctgggc
gtcctctcggtgacgaaccatatgcggatgggcatgcagatcgtcatcgaggattacgtc
cacgacaagggtctgaagatcgccgcggtgatcgccaacaccttctacagcacggtggtg
gcggtcgcctgcctgtacgccatcgtgcggatcagcctgcgcgccttcgcctga

DBGET integrated database retrieval system