KEGG   Methylobacterium sp. 4-46: M446_6106Help
Entry
M446_6106         CDS       T00679                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00010  Glycolysis / Gluconeogenesis
met00071  Fatty acid degradation
met00350  Tyrosine metabolism
met00625  Chloroalkane and chloroalkene degradation
met00626  Naphthalene degradation
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_6106
  Lipid metabolism
   00071 Fatty acid degradation
    M446_6106
  Amino acid metabolism
   00350 Tyrosine metabolism
    M446_6106
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M446_6106
   00626 Naphthalene degradation
    M446_6106
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M446_6106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TGS
Motif
Other DBs
NCBI-ProteinID: ACA20382
JGI: M4466106
UniProt: B0UN20
Position
complement(6713742..6714722)
Genome map
AA seq 326 aa AA seqDB search
MRAMVLHRIGGPLVAETRPDPDPGPGEVRIRVEACAVCRTDLHVIDGDLPDLRLPIVPGH
EIVGRVEALGPGVAAPRPGARVGVPWLGHTCGRCPHCAAGRENLCDRPGFTGYTRDGGFA
THVLAEAAYTIPLPEEADPVATAPLLCAGLIGWRTLRMAGEAATLGLYGFGAAAHIVAQI
CRREGRAVHAFTRPGDRDGQAFARRLGAVWAGDSDAPPPLPLDAALIFAPDGRLVPAALR
AVRKGGTVVCGGIHMSDIPAFPYALLWGERRILSVANLTRADARDFFAAAPRAGIVTHTR
SFPLAEAEAAIAAHRAGLKGAAVLVP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtcctgcaccggatcggcgggcccctcgtcgccgagacccggcccgac
ccggaccccggccccggcgaggtccgcatccgggtcgaggcctgcgcggtctgccggacg
gacctccacgtcatcgacggcgacctcccggacctgcgcctgccgatcgtgcccggccac
gagatcgtcgggcgcgtcgaggccctggggcccggggtggcggcgccgcgtcccggcgcc
cgggtcggcgtgccctggctcggccatacctgcggccgctgcccccattgcgcggcgggc
cgcgagaatctctgcgaccggcccggcttcaccggctacacccgcgacggcggcttcgcc
acgcatgtgctggcggaggccgcctacacgatcccgctccccgaggaggcggatccggtc
gcgaccgcgccgctcctctgcgccgggctgatcggctggcgcacgctgcggatggcgggc
gaggccgcgacgctcggcctctacggattcggggcggccgcccacatcgtggcccagatc
tgccgccgggagggccgcgccgtccacgccttcacccggcccggcgaccgggacgggcag
gccttcgcccgccgcctcggcgccgtctgggcgggcgattcggacgcgcccccgcccctg
cccctcgacgccgccctgatcttcgcccccgacgggcgcctggtcccggcggccctgcgc
gccgtgcgcaagggcgggaccgtggtctgcggcggcatccacatgagcgacatcccggcc
ttcccgtacgcgctgctgtggggcgagcggcggatcctgtcggtggcgaacctgacccgc
gcggatgcgcgggatttcttcgcggcggcgccgcgggccggcatcgtcacccacacccgc
agcttcccgctcgcggaggccgaggcggcgatcgccgcgcaccgggccgggctgaagggg
gccgccgtcctggtgccgtga

DBGET integrated database retrieval system