KEGG   Methylobacterium sp. 4-46: M446_6211Help
Entry
M446_6211         CDS       T00679                                 

Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
met  Methylobacterium sp. 4-46
Pathway
met02020  Two-component system
met02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:met00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M446_6211
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    M446_6211
Enzymes [BR:met01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     M446_6211
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     M446_6211
Two-component system [BR:met02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   M446_6211
Bacterial motility proteins [BR:met02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    M446_6211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR PAS_10 CheB_methylest HWE_HK CheR_N IncA PAS_4 HATPase_c_2 HisKA_2 DUF1664 WEMBL CENP-F_leu_zip DUF3450 Spc7 APG6 TPR_MLP1_2 DUF3584 GAS Exonuc_VII_L UPF0449 Prominin Fez1 MCC-bdg_PDZ Golgin_A5 OmpH HemX TMF_TATA_bd Mnd1 Atg14 HAUS-augmin3 ATG16 CLZ Seryl_tRNA_N HOOK HMMR_N Leu_zip FH2 Snapin_Pallidin IFT57 EzrA HIP1_clath_bdg KASH_CCD TBPIP SesA Sec8_exocyst Spc29 PAS_7 Methyltransf_12 NBP1 ADIP LXG FimP Tropomyosin FapA CALCOCO1 FadA AAA_23 ZnuA Sec20 Baculo_PEP_C RPW8 COG5 DUF4795 AAA_13 DUF812 Prefoldin_3 zf-C4H2 Fmp27_WPPW FPP KELK Rootletin
Motif
Other DBs
NCBI-ProteinID: ACA20478
JGI: M4466211
UniProt: B0UPQ2
Position
6827506..6830691
Genome map
AA seq 1061 aa AA seqDB search
MEADTIASGADDPVGVVLAVSASAASPASLERLLAGPLPSAQVATILILQHREILDEARL
RLALGLSGRGLTAVEDGLPLAGGRLYLPAPGAIATIERGRFRTRPAEQAPGERGVIDSLL
VSLAREENRRAVVVALAGTDGDGTLGVKMIKESGGLALAEETAEARADDLAASNSPAALA
DAILPLDDLADRLRAYVAQLLREDEAMPEGALPSEEIAGALTAVATILRNKTGHDFHGYK
PGTFLRRVQRRMQVVQAESLAAYVEILRAKPDEAQGLFNDLLIGVTQFFRDPGEFDLLER
EVVPALFSGKRRSDQLRVWVIGCSTGEEAYSIAILLREQLADRDEVPQIQIFATDLDGRA
LAAARAGRYADDIAAEMSPERLARWFVREGDTYCVVKEVREMCIFSQHSIVKDAPFSRLD
LISCRNLLIYLDAELQSRVVPLFHFALRPGGFLFLGNSENVSRHTGLFAPIEGRSRIFRR
LETGTRTLPDFPFAAVDRRLAAPAVPPERPRAAEATLTRRAERFAERFAPAYVIVDESYT
VLHFSGRTGRYIDPAGGAASLNLLQLVHPDLRLDLRAALTRAAEHGATVQLDGLRIGLNG
HRLVVDLVVEPVQEAPGAGLSFVVLFKDGAMLASDEDGAPAPSAQTEHAQRLEAELRTTK
DRLQATIEELESTNEELKSSNEEYQSLNEELQSANEELETSKEELQSVNEELTTVNGELG
HRVNELTRATSDLKNFLESTQIATVFLDNDLRVTNSTPAVSEVFHLVESDVGRPIAHIKP
RVAYDELQEDARRVLRTLGTVEREIVNPATGARYMVRVLPYRSVDNFIAGVVVTFVDITA
RLRAEEALRASEGQAKLLLAELQHRVRNTLAVMRSVVRRTALSSDSVEDYAAHLEGRIDA
FARVQSAVTRDPAAGIDLEQLVSHELLAHAAHEGEQVRRIEGPPVRLRPKAAETLALAIH
ELATNAVKHGALTAPSGRVTVTWRIEDRSAPEPLLTLAWIETGVTLSGDPPSRRGFGTEL
IERTLSYELGGSAALSFRPEGMQCHIVLPANDRILVQRERE
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgacacgatcgcttccggggccgacgatccggtcggtgtcgtcctggcggtc
agcgcctccgcggcgagcccggcctccctcgaacggctcctcgccggcccgctgccgagc
gcgcaggtggcgacgatcctcatcctgcagcatcgcgagatcctggacgaggcgcggctg
cgcctcgccctcggcctgtccgggcgcggcctgacggcggtcgaggacgggctccccctg
gcggggggccgcctctacctcccggccccgggggcgatcgccacgatcgagcgcggtcgc
ttccggacccgcccggccgagcaggcgcccggggagcgcggcgtgatcgacagcctgctc
gtgtccctcgcccgcgaggagaaccggcgcgccgtggtggtggcgctcgccgggacggac
ggcgacggcacgctcggcgtcaagatgatcaaggaatcgggcggcctcgccctggccgag
gagaccgccgaggcgcgggcagacgacctcgcggccagcaacagcccggccgcgctcgcg
gacgcgatcctgcccctcgacgacctcgccgaccgcctcagggcctacgtggcgcagctc
ctgcgcgaggacgaggcgatgcccgagggcgcgctccccagcgaggagatcgcgggcgcg
ctcaccgccgtcgccaccatcctgcgcaacaagaccgggcacgacttccacggctacaag
cccggcaccttcctgcgccgggtgcagcggcgcatgcaggtcgtgcaggccgagagcctc
gccgcctacgtggagatcctgcgcgccaagccggacgaggcgcagggcctgttcaacgac
ctgctgatcggggtgacgcagttcttccgcgacccgggcgagttcgacctgctggagcgc
gaggtcgtcccggccctgttctcgggcaagcgccgcagcgaccagctccgggtctgggtg
atcggctgctcgaccggcgaggaggcctactcgatcgcgatcctgctgcgcgagcagctg
gccgaccgggacgaggtgccgcagatccagatcttcgccaccgacctcgacggacgggcg
ctggccgccgcgcgggcgggccgctacgccgacgacatcgccgccgagatgtcgcccgag
cgcctcgcccgctggttcgtcagggagggcgacacctactgcgtcgtcaaggaagtgcgg
gagatgtgcatcttctcccagcacagcatcgtcaaggacgcgcccttctcgcgcctcgac
ctcatctcctgccgcaacctgctgatctacctcgacgcggagctgcagagccgggtcgtc
ccgctgttccacttcgccctgcggccgggcggtttcctgttcctgggcaattccgagaac
gtctcgcggcacacggggctgttcgccccgatcgagggccgctcgcggatcttccggcgg
ctggagaccggcacgcgcacgctgccggacttccccttcgcggcggtcgaccgccgcctg
gcggcgcccgccgtgccccccgagcggccccgcgcggccgaggcgacgctgacgcgccgg
gccgagcgcttcgccgagcgcttcgcccccgcctacgtcatcgtggacgagagctacacg
gtcctgcacttctccgggcggaccggccgctacatcgacccggccgggggcgcggcgagc
ctcaacctgctgcagctcgtgcacccggacctgcgcctcgacctgcgcgccgccctgacc
cgggcggccgagcacggcgcaaccgtgcagctcgacgggctgcgcatcgggctgaacggg
caccggctggtggtcgacctcgtggtcgagccggtccaggaggcgccgggcgcgggcctc
agcttcgtcgtgctgttcaaggacggggcgatgctggcgagcgacgaggacggcgccccc
gctccctccgcccagaccgagcacgcccagcgcctcgaggcggagctgcgcaccaccaag
gaccggctccaggccacgatcgaggagctcgagagcacgaacgaggagctgaaatcctcc
aacgaggagtaccaatccctcaacgaggagcttcagagcgccaacgaggagctcgagacc
tccaaggaggagctccagtcggtcaacgaggagctcaccaccgtcaacggcgagctcggc
catcgcgtcaacgagctgacgcgggcgaccagcgacctcaagaacttcctggagagcacg
cagatcgccacggtcttcctcgacaacgatctgcgggtgacgaactcgacgccggccgtg
tcagaggtgttccacctcgtcgagtcggatgtcggccggccgatcgcccacatcaagccg
cgggtcgcctacgacgagctgcaggaggatgcgcggcgggtgctgcgcacgctcggcacc
gtcgagcgggagatcgtcaacccggccacgggcgcgcgctacatggtgcgggtgctgccc
taccgcagcgtcgacaacttcatcgccggggtcgtcgtcaccttcgtggacatcacggcc
cgcctgcgggccgaggaggccctgcgcgccagcgaggggcaggccaagctcctgctcgcc
gaattgcagcaccgggtgcgcaacacgctggcggtgatgcgctcggtcgtccggcgcaca
gccctgtcgagcgacagcgtggaggattacgccgcccacctggaggggcgcatcgacgcc
ttcgcgcgcgtccagtccgcggtcacccgcgacccggccgcgggcatcgacctggagcag
ctcgtcagccacgaactcctggcccacgcggcgcacgagggcgagcaggtgcgccggatc
gagggcccgccggtgcgcctgcgccccaaggccgccgagaccctggccctcgccatccac
gaactcgccaccaacgcggtcaagcacggggcgctgaccgccccgagcgggcgggtgacg
gtgacgtggcggatcgaggaccggtccgcgcccgagcccctgctgacgctcgcctggatc
gagaccggggtgacgctctcgggggatccgccgtcgcggcgcggcttcggcaccgagctg
atcgagcgcaccctgtcctacgagctcggcggcagcgccgccctgagcttccggcccgag
gggatgcagtgccacatcgtgctccccgccaacgaccggatcctggtccagcgcgagcgg
gagtga

DBGET integrated database retrieval system