KEGG   Methylobacterium sp. 4-46: M446_6351Help
Entry
M446_6351         CDS       T00679                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
met  Methylobacterium sp. 4-46
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6978362..6979399)
Genome map
AA seq 345 aa AA seqDB search
MIEASDRTLSEARPEVGPVLITGASGFLGPALVDVFRAAGFPVRILVRATSPRTNLTWSD
VEVAEGDMRDPAAAAAALRGMRYLVHAAADYRLWAPDPEEIVRTNRDGTRVLMRAALDAG
VERVVYTSSVATIKPHDDGTPADERRPLTPETAIGAYKRSKVVAERVVDEMVARDGLPAV
IVNPSTPIGPRDVKPTPTGRIIVEAANGRMPAFVDTGLNLAHVDDVAAGHLLALRRGRIG
ERYILGGENVLLSRMLADIAGLVGRRPPTIRLPRAAVYPVALVSELAARFTGKAPLATLD
GIRMSRYRMFFSDAKARAELGYAARPYRQGLEDAVAWFRQAGYVR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggcctcggaccgcaccctgtctgaagcccggccggaggtcggcccggtgctg
atcaccggcgcgagcggctttctcggaccggcgctggtcgacgtgttccgcgccgccggc
ttcccggtccgcatcctggtgcgggcgacgagcccgcgcaccaacctgacctggagcgac
gtcgaggtggccgagggcgacatgcgcgacccggccgccgccgccgccgccctgcggggc
atgcgctacctcgtgcacgccgcggccgattaccgcctctgggcgccggacccggaggag
atcgtgcgcacgaaccgcgacggcacccgcgtgctgatgcgggccgccctcgacgcgggc
gtcgagcgggtcgtctacacgtcgagcgtggcgacgatcaaaccgcacgacgacggcacg
cccgccgacgagcggcgcccgctgacgcccgagaccgcgatcggcgcctacaagcgcagc
aaggtcgtggccgagcgcgtggtcgacgagatggtggcccgggacgggctccccgccgtg
atcgtcaatccctcgacgccgatcggcccccgcgacgtcaagccgacgccgaccggccgc
atcatcgtggaggccgccaacggccggatgccggccttcgtcgatacgggcctcaacctc
gcccacgtggacgacgtggcggcgggtcacctcctggccctgcgccgcggccgcatcggc
gagcgctacatcctgggaggcgagaacgtgctcctgtcgcggatgctcgccgacatcgcg
ggcctcgtcgggcgcaggcccccgaccatccggctgccgcgggcggcggtctacccggtc
gccctcgtctccgaactcgccgcccgcttcaccggcaaggcgccgctcgccaccctcgac
gggatccggatgtcgcgttaccggatgttcttctccgacgccaaggcccgggccgaactc
ggctacgccgcgcggccctaccggcaggggctggaggacgccgtcgcgtggttccgccag
gcaggatacgtccgatga

DBGET integrated database retrieval system