KEGG   Methylobacterium sp. 4-46: M446_6455Help
Entry
M446_6455         CDS       T00679                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M446_6455
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M446_6455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M446_6455
Enzymes [BR:met01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     M446_6455
Exosome [BR:met04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M446_6455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7101662..7103491
Genome map
AA seq 609 aa AA seqDB search
MRSRLLALAASVALSGAADAATVMPLDRATILVGSPFDFKVEFEAKVKADEVRITVNGED
YRTALGAGTGFVEVETDKDGKELGSAVLLRGVRIAKPGRYTVEATAGNDRWSVTWEVFGT
ADAPKARNIIFLLGDGLSVAHRTAARLMAKGMTGGKANGRLAMDDLDRMAFIGTSATDAV
ATDSANTMSAYMTGHKTAVNALGVYADRTPASLDDPRVETFAEAVRRQTRKSVGLVVTSE
IEDATPAAVVAHTRRRADKAEIVEMLFSVKPEVILGGGSAYFLPRAVPGSKRRDDKDFIA
LFREAGYALATDRDELQAIAGRDRLLGLFHPGNLDYALDRMQLKKGTVGKFPRQPGLVEM
TRAALDSLSRNPDGFFLMVEGSCIDKASHPLDWERAVFDTIEFDQAVAVARQFQAAHPDT
LVVVTGDHTHGMSVIGTINDDLPGDEMREKVGTYAAAGFPNYEDRDGDGYPDRVDVSRRL
ALFGTNGPDHYETFRPKLDGPFEPALKTQGGTYVANDKYKDVPGAVLVKGNIPKDEESGV
HAVDDVVLQAAGPGAEGFKGYMEESDVYRVLADAFALGATRTVANSPAGQASAGEASAGK
ASAGKTPSK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacgtcttctcgccctcgcagccagcgtcgccctctccggtgccgccgacgcc
gccaccgtcatgccgctcgaccgcgccaccatcctggtcggctcgcccttcgacttcaag
gtcgagttcgaggccaaggtgaaggcggacgaggtcaggatcaccgtcaacggcgaggat
taccggacggccctcggcgcgggcaccggcttcgtcgaggtcgagacggacaaggacggc
aaggagctcggctcggccgtgctcctgcgcggggtcaggatcgccaagcccggccgctac
acggtggaggcgacggccggcaacgaccgctggagcgtgacctgggaagtcttcggcacc
gccgacgcgcccaaggccaggaacatcatcttcctgctcggcgacgggctgtcggtcgcc
catcgcaccgccgcgcgcctgatggccaagggcatgaccgggggcaaggccaacggccgc
ctcgccatggacgatctcgaccgcatggccttcatcggcacctcggccaccgacgcggtc
gccaccgacagcgccaacacgatgtcggcctacatgaccggccacaagacggcggtgaac
gccctcggcgtctacgccgaccgcacgcccgcctccctcgacgacccccgggtggagacc
ttcgcggaggcggtccggcgccagacgcggaaatccgtcggcctcgtggtcacctcggag
atcgaggacgcgaccccggccgccgtcgtggcgcatacccgccgccgcgccgacaaggcc
gagatcgtcgagatgctcttttccgtgaagccggaggtgatcctcggcggcggctcggcc
tatttcctgccgagggccgtgccgggctcgaagcgccgggacgacaaggacttcatcgcg
ctgttccgggaggccggctacgcgctcgccaccgaccgggacgagctccaggcgatcgcc
ggccgcgaccggctgctcggcctgttccacccgggcaacctcgactacgcgctcgaccgg
atgcagctcaagaagggcacggtcggcaagttccccaggcagcccggcctcgtcgagatg
accagggccgcgctggacagcctgtccaggaatccggacggcttcttcctgatggtggag
gggtcctgcatcgacaaggcgagccacccgctcgactgggagcgggcggtcttcgacacg
atcgagttcgaccaggccgtcgcggtggcgcgccagttccaggccgcccatcccgacacg
ctcgtcgtcgtgaccggcgaccacacccacggcatgtcggtgatcggcaccatcaacgac
gacctgccgggcgacgagatgcgcgagaaggtcggcacctacgcggccgccggcttcccg
aactacgaggacagggacggcgacggctatcccgaccgcgtcgacgtctcgcgccgcctc
gccctgttcggcaccaacggccccgaccattacgagaccttccggcccaagctcgacggc
ccgttcgagccggcgctgaagacccagggcggcacctacgtcgccaacgacaagtacaag
gacgtgcccggcgcggtcctggtcaagggcaacatccccaaggacgaggaatcgggcgtc
cacgcggtcgacgacgtggtgctgcaggcggccggccccggcgccgaaggcttcaagggc
tacatggaggagagcgacgtctaccgggtgctggcggacgccttcgccctcggcgccacg
aggacggtggccaattcgccggcaggccaggcttcggcaggcgaggcttcggcaggcaag
gcgtcggcaggcaagacgccaagcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system