KEGG   Methylobacterium sp. 4-46: M446_6833Help
Entry
M446_6833         CDS       T00679                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00071  Fatty acid degradation
met00280  Valine, leucine and isoleucine degradation
met00281  Geraniol degradation
met00310  Lysine degradation
met00360  Phenylalanine metabolism
met00362  Benzoate degradation
met00380  Tryptophan metabolism
met00410  beta-Alanine metabolism
met00627  Aminobenzoate degradation
met00640  Propanoate metabolism
met00650  Butanoate metabolism
met00903  Limonene and pinene degradation
met00930  Caprolactam degradation
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M446_6833
   00650 Butanoate metabolism
    M446_6833
  Lipid metabolism
   00071 Fatty acid degradation
    M446_6833
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M446_6833
   00310 Lysine degradation
    M446_6833
   00360 Phenylalanine metabolism
    M446_6833
   00380 Tryptophan metabolism
    M446_6833
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M446_6833
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M446_6833
   00281 Geraniol degradation
    M446_6833
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M446_6833
   00627 Aminobenzoate degradation
    M446_6833
   00930 Caprolactam degradation
    M446_6833
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M446_6833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ACA21078
JGI: M4466833
UniProt: B0UJ66
Position
complement(7530957..7532018)
Genome map
AA seq 353 aa AA seqDB search
MAGDMAGDAETHVLVERRGTAGCLTLNRPQALNALDLGMVRRLRAALDAWLADPGVTRIV
LRGAGRAFCAGGDIRHLHDEARARGPRAPDAFWREEYALNALIHRYPKPIVSLIDGIVMG
GGVGLSLHGAHRVAGERYLFAMPEVGIGFFPDVGATYALPRLPGAFGTYLALTGDRVGPG
DGLAFGLATRAAPAPAFEAITERLAAGEPVEAALGESEAPPPGPLHAAREVIDSCFSAES
VAAVLARLDAAAREGSGFAGKAAATIRTRSPTSVAVAFAQMRRGIAMSFPEAMLTEYRIV
TRILEGHDFYEGVRATLIDKDGAPRWRPERLEAVTAEAVEAHFAPLPDEPRFA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgatatggcgggcgacgcggagacccacgtcctggtcgagcggcgggggacg
gcggggtgcctcaccctcaaccgcccgcaggccctcaacgcgctcgatctcggcatggtg
cggcgcctgcgcgccgccctcgacgcgtggctggcggatcccggggtgacgcgcatcgtg
ctgcgcggcgccgggcgcgccttctgcgcgggcggcgacatccggcacctccacgacgag
gcgcgggcgcggggcccgcgggcgcccgacgccttctggcgggaggaatacgcgctcaac
gccctgatccaccgctaccccaagccgatcgtgtcgctgatcgacgggatcgtgatgggc
gggggcgtcgggctgtcgctgcacggcgcgcaccgcgtcgcgggggagcgctacctgttc
gcgatgccggaggtggggatcggcttcttcccggatgtcggggcgacctacgcgctgccg
cgcctgccgggcgccttcggaacctacctcgccctcaccggcgaccgggtcgggccgggg
gacggcctcgccttcgggctcgcgacgcgggcggcgccggcccccgccttcgaggcgatc
acggagcggctcgccgcgggggagccggtcgaggcggcgctgggcgagagcgaggcgccc
ccgcccgggccgctccacgccgcccgcgaggtgatcgattcctgcttctcggccgagagc
gtggcggcggtgctggcccggctcgacgcggcggcgcgggagggctccggcttcgcgggc
aaggccgccgccacgatccgcacgcgctcgcccaccagcgtcgccgtcgccttcgcgcag
atgcgccggggcatcgccatgagtttcccggaggcgatgctgaccgagtaccggatcgtc
acccgcatcctcgaaggacacgacttctacgagggggtgcgcgccaccctgatcgacaag
gacggcgccccgcgctggcggcccgagcgcctcgaggcggtcacggcggaggcggtggag
gcgcatttcgcgcccctgcccgacgagccccggttcgcctga

DBGET integrated database retrieval system