KEGG   Methylobacterium sp. 4-46: M446_6834Help
Entry
M446_6834         CDS       T00679                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
met  Methylobacterium sp. 4-46
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M446_6834
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     M446_6834
Exosome [BR:met04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M446_6834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7532216..7533268
Genome map
AA seq 350 aa AA seqDB search
MSQIQPFVRPLARDAARTETAPGLSLTQRPRRNRKAEWSRRLVRETVLTLDDLIWPLFVI
EGERRREPVPSMPGVERLSVDEAVREAERAAALRIPAIAFFPYVEPSLRDETGSEALNRN
NLVCRAVRAVKAAVPELGVITDVALDPYTSHGHDGLLDDTVIVNDETVALLVEQSLIQAE
AGTDVIAPSDMMDGRVGAIRAGLDRSGFRDVQIMAYAAKYASAFYGPFRDAIGTSATLKG
DKRTYQMDPGNTEEALREVALDLEEGADSVMVKPGLPYLDIIRRVKEGFGVPTFAYQVSG
EYAMIAAAAQNGWLDGERAMIESLVAFKRAGADGIFTYFAPRVAERLRAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagatccagcccttcgtccggcccctcgcccgcgacgccgcccggaccgagacc
gcccccggcctgtccctgacccagcggccgcgccgcaaccgcaaggcggagtggtcgcgc
cggctcgtgcgcgagaccgtgctgaccctcgacgacctgatctggccgctcttcgtcatc
gagggcgagcgccggcgcgagccggtgccctccatgccgggcgtcgagcggctgagcgtc
gacgaggcggtgcgcgaggccgagcgcgcggccgccctgcggatcccggccatcgccttc
ttcccctacgtcgagccctcgctgcgggacgagaccggctcggaggcgctcaaccgcaac
aacctcgtctgccgggcggtgcgggccgtgaaggcggcggtgccggaactcggcgtgatc
acggacgtcgccctcgacccctataccagccacggccatgacgggctcctcgacgacacc
gtgatcgtcaacgacgagaccgtggcgctcctggtcgagcagagcctgatccaggccgag
gccggcaccgacgtgatcgccccctccgacatgatggacgggcgcgtcggcgcgatccgc
gcggggctcgaccgctcgggcttccgcgacgtgcagatcatggcctacgcggccaagtac
gcgagcgccttctacggcccgttccgggacgcgatcggcaccagcgcgacgctcaagggc
gacaagcgcacctaccagatggaccccggcaacaccgaggaggcgctgcgcgaagtcgcg
ctcgacctggaggagggggccgattccgtgatggtgaagcccggccttccctacctcgac
atcatccggcgggtgaaggaaggcttcggcgtgccgaccttcgcctaccaggtctcgggc
gagtacgcgatgatcgcggcggcggcccagaacggctggctcgacggcgagcgcgccatg
atcgagagcttggtggccttcaagcgcgcgggcgcggacggcatcttcacctatttcgcg
ccgcgggtcgcggagcgcctgcgggccgggtga

DBGET integrated database retrieval system