KEGG   Methylobacterium sp. 4-46: M446_6964Help
Entry
M446_6964         CDS       T00679                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
met  Methylobacterium sp. 4-46
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M446_6964
Enzymes [BR:met01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     M446_6964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7657626..7658630
Genome map
AA seq 334 aa AA seqDB search
MTSPADDPTRAARLARFQPLSGMAMPRFAGLASLMRLPVLSPEAAIAEPVEIGLFGIPFD
SATTNRPGARLGPRGVREQSALMRLVNPATGICPYELCACADLGDVAVNPVDVADTLGRI
EAFAAPLRAAGLTLLAVGGDHLVSYPLLRTVAAGRPVGLIHIDAHSDTTDSYFGGAKLTH
GTPFRRAIEDGVLDPRRTVQIGLRGTLYARDERQWALDQGIRILDMERVIAEGLPAAVTE
ARAVVGAGPTYLTFDIDSIDPAFAPGTGTPEIGGFTSREALFLLRGLRGLDLVGADLVEV
APPLDPSGTTALVGATIAFELLCLLAEARARRAG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccggccgacgatccgacccgcgccgcgcggctcgcgcgcttccagcccctc
tccgggatggcgatgccgcgcttcgccggcctcgccagcctgatgcgcctgccggtgctg
agcccggaggcggccatcgccgagccggtcgagatcggcctgttcggcatccccttcgac
agcgccaccaccaaccgcccgggcgcgcgcctggggccgcgcggcgtgcgcgagcaatcg
gcgctgatgcgcctcgtcaacccggcgaccgggatctgcccctacgagctctgcgcctgc
gcggatctcggggacgtggcggtcaacccggtcgacgtcgccgacacgctcggccgcatc
gaggcgttcgcggcgcccctgcgcgcggcggggctgacgctcctcgcggtcgggggcgac
cacctcgtcagctacccgctcctgcgcacggtcgcggcgggccggccggtggggctgatc
cacatcgacgcccacagcgacaccaccgacagctatttcggcggcgccaagctcacgcac
ggcacgccgttccggcgcgccatcgaggacggcgtcctcgacccgcggcgcaccgtccag
atcggcctgcgcggcacgctctacgcccgcgacgagcggcaatgggccctcgaccagggc
atccgcatcctcgacatggagcgggtgatcgccgaggggctgcccgccgcggtcaccgag
gcccgcgcggtggtcggggccgggccgacctacctgaccttcgacatcgattccatcgac
ccggccttcgcccccgggacgggcacgccggagatcggcggcttcacctcccgcgaggcg
ctcttcctcctgcgcggcctgcgcggcctcgacctcgtcggcgccgacctcgtggaagtc
gccccgcccctcgacccctccggcaccacggccctcgtcggcgcgaccatcgcgttcgag
ctgctctgcctcctcgccgaggcgcgggcgcgccgcgccgggtga

DBGET integrated database retrieval system