KEGG   Methanobacterium sp. MB1: MBMB1_0710Help
Entry
MBMB1_0710        CDS       T02957                                 

Definition
putative protein MJ1136
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
meth  Methanobacterium sp. MB1
Brite
Enzymes [BR:meth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MBMB1_0710
Transfer RNA biogenesis [BR:meth03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MBMB1_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686231..687850)
Genome map
AA seq 539 aa AA seqDB search
MEKAGRSIIEDILEGKIKNRKDLEKAKFKVCREYQLDRFPRNSEILETAREDEKEFVIPI
LKKKPTRTISGVAVVAVMCPPHKCPHGRCLYCPESAIAPPSYTGEEPAALRARMYDFNPY
KQVYNRLNQLKTIGHPLDKVELIIMGGTFPSRFLCFQEWFITQCLQAMNDFGVKEYNLNS
SDTIESAGGFSYLKDAQLANENSRVRCVGMTFETRPDYSQREDVDRMLKMGVTRVELGVQ
TLYNFIYHRVCRGHRVQDTVEATRILKDSGIKVAMHMMPGLFSGPERDLRMFKRLFSDEQ
FKPDMLKIYPCLVTEGSQLHELWKKGEYTPYSSEEAVQLIVEVKKILPKWVRTMRIQRDI
PSTLIEAGVQKSNLGELVYNQLKKENIQCQCIRCREVGHQAAQGTHTQKENIKLLVEKYR
ASQGEELFLSKEDTKADVLLGFLRLRIPSEKAHRPEINDKSALIRELHVYGPMMPLGERA
DELWQHRGYGEELLKKAEEISREEYDKKEILIISGIGVRNYYRKFGYERKGPYMAKKLI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagccggaagatccataatagaggatatactggaagggaaaataaaaaaccgg
aaggatctggagaaggccaagttcaaggtatgccgagaatatcaattggaccggttcccc
cgtaactctgaaatactagaaacggcccgagaagatgaaaaagagtttgttatccctatt
ttgaaaaagaaacccacccggacaatttctggtgtggctgttgtggctgtaatgtgccca
ccccataaatgtcctcatggaagatgtttgtattgtccagaaagtgcaatagctcctccc
agttacactggcgaagagcccgctgccttaagggccaggatgtatgatttcaacccttat
aaacaggtttacaatcgcctgaatcagttaaaaactattggacaccccttagataaggtg
gagctcataataatgggaggtaccttcccctctagatttttatgcttccaggaatggttc
attacccagtgtctccaggccatgaatgattttggagttaaagagtataacttgaactcc
agtgatactatagagagtgctgggggtttcagttatcttaaggatgcccaactggccaat
gaaaattccagagtccgctgtgtaggcatgaccttcgaaacacgaccggattactcccag
agagaggatgtggatcggatgctgaagatgggtgttacccgggtggagttaggggtgcaa
accctctataacttcatttatcaccgagtatgtcgtggacaccgggtgcaggacacagta
gaagctacacgaattttaaaggattcaggtattaaagtggctatgcacatgatgccgggt
ctatttagtggtccggaaagggatttgcgaatgttcaagaggttgttttccgatgaacag
ttcaaaccagatatgcttaagatctatccctgcctggtaaccgaaggctcccaactccat
gaactatggaaaaaaggagaatacactccttactccagtgaagaagcagtgcagttaata
gtggaggttaaaaagatactgcccaaatgggtgcgtaccatgcgtatacagagggatatt
ccctccacactcatagaagcaggtgtacaaaaatccaacctaggagaactggtttacaat
cagcttaaaaaggaaaacattcagtgccaatgcatccgttgccgggaagtgggacaccag
gcagcccagggaacccacactcagaaagaaaacattaaactcttggtggagaagtaccgt
gccagtcagggtgaagaactattcctgtccaaggaggataccaaggcagatgttcttctc
ggatttttaagactacgaataccctccgaaaaagcccatcgtccggaaattaatgataaa
agtgccttaatacgcgaattacatgtttacggccctatgatgccactgggtgaacgggca
gatgaactttggcagcaccgaggatacggtgaagagttacttaaaaaagctgaagagatc
agccgagaagagtatgataaaaaggaaatactcattatcagtggaattggagttcgtaac
tactaccgtaaatttggttatgaaaggaaaggcccttatatggctaaaaaattgatttaa

DBGET integrated database retrieval system