KEGG   Methanobacterium sp. MB1: MBMB1_0906Help
Entry
MBMB1_0906        CDS       T02957                                 

Gene name
GAD2
Definition
Glutamate decarboxylase 2 (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
meth  Methanobacterium sp. MB1
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:meth00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MBMB1_0906 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MBMB1_0906 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MBMB1_0906 (GAD2)
   00430 Taurine and hypotaurine metabolism
    MBMB1_0906 (GAD2)
Enzymes [BR:meth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MBMB1_0906 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883390..884784
Genome map
AA seq 464 aa AA seqDB search
MLSGKKDLKKLDKSQREHNTATTAYGTRYFEKSIPKYEIPLDGMPADAAYQLIHDELNLD
GNPVLNLASFVTTWMEPQADKLIMESVDKNYVDADEYPQTQKIEERVVNILARLFNSPDD
CHSIGTATIGSSEAIMLALLAHKWTWRENRKAEGKPTDKPNIVMGADVHTVWEKFAKYFD
VELKLIPIKDDLYTITAEDVAKEVDENTIAVGAVIGTTFTGQMDPIKEINDVLMDIKKEK
GWNIPIHVDGASGGFIAPFIHPDMEWDFRLEQVRSINVSGHKYGLVYPGVGWVVFKDKSD
VPEDLVFNINYLGGSMSNYSLNFSKASNTIIAQYYNLIRLGFNGYKAVIDNMIENTRYMA
DKLEETGRFEVLNPKILFPLVTVKLKDSDFTVFQLSDKLREHGWIVPAYTLPANADDIAV
LRMVIKENFGRDMVNAFIDDIKTCCKNLESEEEKIKKEDPSLLY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatctggaaaaaaagatctcaaaaaattggacaaatcacaaagagaacataatact
gcaaccactgcttatggaaccaggtattttgaaaagagcatacctaaatatgagatacca
cttgatggtatgcctgccgatgctgcttatcaattaatccatgatgaattaaatttagac
ggtaatcctgtcttgaatctggcaagctttgtaaccacctggatggagccacaggcagat
aagttgattatggaatctgtggataaaaactacgtggacgctgatgagtaccctcagact
cagaagatagaagaaagagtggttaacatactggccagactgttcaactcaccagatgac
tgccattccattggtactgccaccattggatcatcagaggctataatgctggccctcctt
gcacataaatggacatggagggagaacagaaaagctgaagggaaacctacagataaaccc
aacatagtcatgggtgcagacgttcacacagtatgggagaaatttgccaaatatttcgat
gtagaattaaagctcatccccataaaggatgatctgtacaccataactgcagaggatgtt
gccaaagaagttgatgaaaacaccatagcagtaggggcagttattggaaccacttttact
ggacaaatggatcctattaaagagataaatgatgttttaatggacattaaaaaagaaaaa
ggatggaacataccaatccatgtagatggtgccagtggtggatttatagctccattcata
catccagatatggaatgggatttcagactcgaacaggtaagatccataaatgtatccgga
cacaaatacggcctggtttatcctggtgttggctgggtggtatttaaagacaaatcagat
gtacctgaagacttagtatttaacatcaattacctgggtggtagtatgagtaattattcc
cttaacttctccaaggcgagcaacactatcatcgcccagtactacaacctcatccgctta
ggattcaatggctataaggcagtcattgataacatgattgaaaatacaaggtacatggca
gataaactagaagaaacaggtagatttgaagttctaaatccaaagatcttattccctctg
gtcacagttaaattgaaagactcagacttcacagtcttccaactttcagataaactccga
gaacatggttggatagtaccggcctatacactaccagcaaatgctgatgatatagctgtc
ctaaggatggtaatcaaggagaattttggaagagatatggtaaatgctttcattgatgac
ataaaaacatgttgtaagaacctggaatcagaggaagaaaagattaaaaaggaagatcca
tctctgctctactaa

DBGET integrated database retrieval system