KEGG   Methanobacterium sp. MB1: MBMB1_1420Help
Entry
MBMB1_1420        CDS       T02957                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
meth  Methanobacterium sp. MB1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:meth00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MBMB1_1420
Enzymes [BR:meth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MBMB1_1420
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MBMB1_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394887..1395672
Genome map
AA seq 261 aa AA seqDB search
MPELPTLEIYKKYFDETSLHQTIKQVQVVSPEVLMDTSSEQIKETLLNHEFIQSYRYGKY
LFAQLDNSLFLTMHFGMTGLLHYGSRDGSPYPRLLIKFSTGNFLSFDDARKFGKIGLTNN
PDKFIKEKKLGPDALEIDFKSFREAFQNRKGMIKPLLLNQHVLAGIGNLYADEILYQSHV
HPLTPAHLLDEEEWKQLFHNMKKVLRKAIECHDKPKTLPQSYLLPHRHPGGKCPEGGCEL
KIIPVGGRTTYFCPQRQKIKS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccaccctggagatctataaaaaatatttcgatgaaacttccctccat
caaaccattaaacaggtacaagtggttagtcccgaagttctgatggatactagtagtgag
caaattaaagaaacactactaaatcatgaattcatacaaagttaccgctatgggaaatat
cttttcgcccagcttgataatagcctgtttttaacaatgcactttggaatgaccggctta
cttcactatggatctcgtgatggttccccatatccacgtcttttaataaagttttccaca
gggaattttctatcctttgatgatgcccgtaaatttgggaagataggtttaactaacaat
ccagataaattcattaaagagaaaaaattaggccctgatgccctggaaatagacttcaaa
agttttagagaagcttttcaaaacagaaaaggtatgatcaaaccattactcctgaaccaa
cacgtgttggcgggtattggcaatctttacgccgatgaaatactttatcagagccatgta
caccccttaacccctgctcatctactggatgaagaggaatggaaacaactattccataat
atgaaaaaggtgcttcggaaggccattgaatgccatgataaaccaaaaacactccctcaa
tcctatctattaccccatcgccaccctggaggtaaatgtccagaaggagggtgtgaatta
aaaatcataccagtgggtggtcgcactacctacttctgtccccaaaggcaaaaaataaaa
tcttag

DBGET integrated database retrieval system