KEGG   Methanohalobium evestigatum: Metev_0068Help
Entry
Metev_0068        CDS       T01261                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00790  Folate biosynthesis
mev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metev_0068
Enzymes [BR:mev01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Metev_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADI73000
JGI: Metev_0068
UniProt: D7E5X8
Position
76317..77561
Genome map
AA seq 414 aa AA seqDB search
MDGTGKIMAVDSDICGLKVGDEHPVRLMGVINLSQESFYKNSVIDKDSIINTAQDMVDKG
ATMIDVGGRSTWPLAEKITKKQETERLLPALEELKGNVDAVISVDTMFADIAEESLKRGV
DVVNDVSGLTADSRMVDLIADYDCPAVVMASYQTPGDPFGMDAVMDSLSSIIKKAESKDI
DPNKLILDPAFGKWVPEKDPIYDFETADQFERLKIFEKPLLAAVSRKSMIKAVTGKPAEE
RLYGSLAATSLVVHKGADIIRTHDIHQTKDVVDVAKAIRSRSPYVRKNGFEVSVLDVNHP
SDAAYLIQSIGATTSGSNVMKKKSVYRVLRINNITTTEALIIKQEMLARGADAAISRDAV
SHEDESTDVILMGTLLQIEQLVDKLSCQARNLPLIADMIEETLEQYTDTKYLYQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaccggtaaaatcatggctgttgattctgatatatgtggacttaaggttgga
gatgagcatcctgtacgtttaatgggcgttataaatctaagtcaggaatctttctataaa
aactcggtaatcgataaagattctataattaacactgctcaggatatggttgataaagga
gcaaccatgattgatgtgggcggacgttccacatggccgctggctgaaaagataaccaag
aaacaggaaacagaacggttgcttccagcactggaagaacttaaaggtaatgtggatgct
gttatttctgtagataccatgtttgcagacattgccgaagaatcattgaaacggggtgta
gacgttgtaaatgatgtttcaggtttaactgctgattccaggatggtagatttgattgct
gattatgattgtcctgcagttgtaatggcatcctatcaaacacccggtgaccctttcggt
atggatgcagttatggattcgcttagttcgataataaaaaaagcagaatcaaaagatatt
gatcccaataaactaatacttgacccggcgtttggtaaatgggtgcctgaaaaagaccca
atatatgattttgagaccgctgatcagtttgaacgcctcaaaatatttgaaaagccgcta
cttgcagcagtatcacgtaaatccatgataaaggcagtaacaggaaaacctgcagaagaa
cgtctgtatggtagtcttgcagctacatctttggtagtacacaagggtgcggatataata
agaactcatgatatacaccagacaaaagatgttgttgatgtagcaaaagcaatacgaagc
cgtagtccatatgtcaggaaaaacgggtttgaagtatcggtcctggacgtaaatcatcca
tcggatgcggcttacctgattcaatcaatcggtgctactacatcgggttccaacgttatg
aagaaaaaatcagtttaccgcgtgcttaggattaacaacatcacaaccactgaagcgctt
attataaaacaggaaatgcttgcaaggggagcagatgcagcaatctctcgtgatgcggta
tctcatgaggatgaatctactgatgtgatacttatgggaacattgttgcagatagaacaa
cttgtggacaaactgtcctgtcaggcacggaatcttcccttaattgcggatatgattgaa
gagacactggaacagtatacagatacaaagtacctctatcaataa

DBGET integrated database retrieval system