KEGG   Methanohalobium evestigatum: Metev_0181Help
Entry
Metev_0181        CDS       T01261                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_0181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0181
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0181
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(185857..187161)
Genome map
AA seq 434 aa AA seqDB search
MEQTKILLDENEMPKQWYNILPDLPTPVEPPLNPETKEPIKPEELESIFPKSLIEQEMSS
DNYIDIPEEIRDIYKLWRPSPLHRAHRLEELLDTPAKIYYKNEGVSPAGSHKPNTSIAQV
YYNMKEGNERVTTETGAGQWGSALSLACNYFDLECKVYMVRSSFEQKPFRKSLINLWGAT
VIPSPSKETKFGQQFLEQYPDTTGSLGIAISEAIEDASENDNTKYALGSVLNHVMLHQTV
IGLESQKQLEKVDEYPDIVIGCCGGGSNLAGISFPYIKDKINKKHDPEIIGVEPSACPTL
TEGSFKYDSGDTAMMTPLLKMYTLGHDFVPPSIHSGGLRYHGCSPIISRLYDDGLMKGRN
YHQVEIFDSAVKFARTEGIVPAPESSHAIKCAMDEATKCRETGEEKTILFNLSGHGHFDM
SAYDKYFNKKLGNE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacaaaaattttacttgatgaaaatgaaatgccaaagcagtggtacaatata
ttgccagatcttcctactcctgttgaaccaccacttaaccctgaaacaaaagaaccaata
aaaccagaagaactggaatcaatatttccaaaatcattaattgagcaggagatgtcttct
gacaattatatagatattcctgaagaaattcgcgatatctacaagttatggagaccttca
ccacttcaccgcgcccatagacttgaagaattgctggatacccctgcaaaaatctattac
aaaaatgaaggagtaagccctgcaggcagtcacaaacccaacacctcgattgcacaggta
tactacaacatgaaagaaggtaatgaaagggtaactaccgaaaccggtgcaggacaatgg
ggtagtgcactatcacttgcctgcaactattttgacttggaatgtaaggtttacatggta
cgctccagttttgaacaaaaacccttcagaaaatccttaatcaacctctggggagccact
gttattccatcacccagtaaagaaactaaatttggacaacaattcctcgaacaatatcct
gacacaacaggaagtcttggcattgccatcagtgaagccattgaagatgcatcagagaac
gataatacaaaatacgctcttggaagtgttttaaatcacgtaatgctacaccaaacagtt
ataggtcttgaatcacagaaacagttagaaaaagttgatgaatacccagatattgtcata
ggatgttgtggcggaggcagtaaccttgcgggaatcagttttccgtatataaaggataag
ataaacaaaaaacatgacccagaaataataggtgttgaaccatctgcctgccccactctt
acagaagggagctttaaatacgattcaggagatactgcaatgatgactccactgcttaaa
atgtacacactggggcatgattttgtacccccgtccattcactcggggggacttaggtat
catggatgttcaccaataataagcagattatatgacgacggattgatgaaaggcagaaac
taccaccaggttgagatttttgattctgctgttaaatttgccagaaccgaaggtattgtg
ccagcacctgaatcatctcatgccataaaatgtgcgatggatgaagcaacaaaatgcaga
gaaaccggtgaagaaaaaaccattcttttcaatctaagtggacacggacactttgatatg
tcagcttatgataaatattttaacaaaaaactgggcaacgaataa

DBGET integrated database retrieval system