KEGG   Methanohalobium evestigatum: Metev_0181Help
Entry
Metev_0181        CDS       T01261                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_0181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0181
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0181
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(185857..187161)
Genome map
AA seq 434 aa AA seqDB search
MEQTKILLDENEMPKQWYNILPDLPTPVEPPLNPETKEPIKPEELESIFPKSLIEQEMSS
DNYIDIPEEIRDIYKLWRPSPLHRAHRLEELLDTPAKIYYKNEGVSPAGSHKPNTSIAQV
YYNMKEGNERVTTETGAGQWGSALSLACNYFDLECKVYMVRSSFEQKPFRKSLINLWGAT
VIPSPSKETKFGQQFLEQYPDTTGSLGIAISEAIEDASENDNTKYALGSVLNHVMLHQTV
IGLESQKQLEKVDEYPDIVIGCCGGGSNLAGISFPYIKDKINKKHDPEIIGVEPSACPTL
TEGSFKYDSGDTAMMTPLLKMYTLGHDFVPPSIHSGGLRYHGCSPIISRLYDDGLMKGRN
YHQVEIFDSAVKFARTEGIVPAPESSHAIKCAMDEATKCRETGEEKTILFNLSGHGHFDM
SAYDKYFNKKLGNE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacaaaaattttacttgatgaaaatgaaatgccaaagcagtggtacaatata
ttgccagatcttcctactcctgttgaaccaccacttaaccctgaaacaaaagaaccaata
aaaccagaagaactggaatcaatatttccaaaatcattaattgagcaggagatgtcttct
gacaattatatagatattcctgaagaaattcgcgatatctacaagttatggagaccttca
ccacttcaccgcgcccatagacttgaagaattgctggatacccctgcaaaaatctattac
aaaaatgaaggagtaagccctgcaggcagtcacaaacccaacacctcgattgcacaggta
tactacaacatgaaagaaggtaatgaaagggtaactaccgaaaccggtgcaggacaatgg
ggtagtgcactatcacttgcctgcaactattttgacttggaatgtaaggtttacatggta
cgctccagttttgaacaaaaacccttcagaaaatccttaatcaacctctggggagccact
gttattccatcacccagtaaagaaactaaatttggacaacaattcctcgaacaatatcct
gacacaacaggaagtcttggcattgccatcagtgaagccattgaagatgcatcagagaac
gataatacaaaatacgctcttggaagtgttttaaatcacgtaatgctacaccaaacagtt
ataggtcttgaatcacagaaacagttagaaaaagttgatgaatacccagatattgtcata
ggatgttgtggcggaggcagtaaccttgcgggaatcagttttccgtatataaaggataag
ataaacaaaaaacatgacccagaaataataggtgttgaaccatctgcctgccccactctt
acagaagggagctttaaatacgattcaggagatactgcaatgatgactccactgcttaaa
atgtacacactggggcatgattttgtacccccgtccattcactcggggggacttaggtat
catggatgttcaccaataataagcagattatatgacgacggattgatgaaaggcagaaac
taccaccaggttgagatttttgattctgctgttaaatttgccagaaccgaaggtattgtg
ccagcacctgaatcatctcatgccataaaatgtgcgatggatgaagcaacaaaatgcaga
gaaaccggtgaagaaaaaaccattcttttcaatctaagtggacacggacactttgatatg
tcagcttatgataaatattttaacaaaaaactgggcaacgaataa

DBGET integrated database retrieval system