KEGG   Methanohalobium evestigatum: Metev_0223Help
Entry
Metev_0223        CDS       T01261                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mev  Methanohalobium evestigatum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mev00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(223424..224401)
Genome map
AA seq 325 aa AA seqDB search
MFPQVRMRRLRQGKLQNLVRETTITADDLICPVFVDENIETPQEVPSMPGTYKLPVDYAA
DEAKEISDLGIPSIMIFGVPARKDESGSSAWGNNEVVQRAVRNIRNDISSRDMAIITDVC
LCEYTTHGHCGVVDYDKEEILNDPTLPLLGKTAVSHAEAGADMVAPSGMMDGMVESIRSE
LDNNNFENIPIMSYAAKYFSAFYGPFRDAAESGYSFGDRSSYQMNPSNSNEAIREVELDI
DEGADIVMVKPALPYLDILYRIKDELEMPTAAYNVSGEYAMIKAAAQNGWMDENKIIYES
ITSIKRAGADMILTYFAKDMAKLLK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttccacaggtacggatgagaagattaaggcaagggaagctacaaaatcttgtacgt
gagacaacaattactgcagatgacctgatatgtcctgtttttgtcgatgaaaatattgag
acaccacaggaagtgccctcaatgccgggtacttataaattaccggtcgattatgcagca
gacgaagctaaagaaatctcagatcttggtattccatcgataatgatttttggagttcct
gccagaaaagatgagtctgggagttctgcgtggggtaacaatgaagttgtacagcgtgct
gtcagaaacatcagaaacgatatttcaagcagggatatggctataattaccgatgtctgt
ctttgtgaatacacaacccacggacattgcggtgttgtggactatgataaagaagaaata
ttgaacgaccccactttaccattacttggaaaaactgctgtaagccatgcagaagcaggt
gcagatatggttgctccatccgggatgatggatggcatggtagaatccatcaggtccgaa
cttgataacaataattttgaaaacattcctataatgtcctatgcggctaagtatttctcg
gctttctacggtccttttagagatgccgctgaatcaggttattcctttggcgacaggtca
agttatcagatgaacccttcaaattccaatgaagcaatccgtgaagtggaactggacatt
gatgaaggtgctgacattgtaatggtcaaacccgcactcccgtaccttgacatactatac
cgaatcaaagatgaacttgaaatgccgactgctgcatataatgtaagtggtgaatatgcg
atgataaaagccgctgcacagaacggatggatggacgagaacaaaataatttatgaatca
attacatccattaaacgtgccggagcggatatgatacttacctactttgccaaagatatg
gcaaagcttttgaaataa

DBGET integrated database retrieval system