KEGG   Methanohalobium evestigatum: Metev_0223Help
Entry
Metev_0223        CDS       T01261                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00860  Porphyrin and chlorophyll metabolism
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
Module
mev_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metev_0223
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metev_0223
Exosome [BR:mev04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metev_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD MukB_hinge
Motif
Other DBs
NCBI-ProteinID: ADI73153
JGI: Metev_0223
UniProt: D7E6D1
Position
complement(223424..224401)
Genome map
AA seq 325 aa AA seqDB search
MFPQVRMRRLRQGKLQNLVRETTITADDLICPVFVDENIETPQEVPSMPGTYKLPVDYAA
DEAKEISDLGIPSIMIFGVPARKDESGSSAWGNNEVVQRAVRNIRNDISSRDMAIITDVC
LCEYTTHGHCGVVDYDKEEILNDPTLPLLGKTAVSHAEAGADMVAPSGMMDGMVESIRSE
LDNNNFENIPIMSYAAKYFSAFYGPFRDAAESGYSFGDRSSYQMNPSNSNEAIREVELDI
DEGADIVMVKPALPYLDILYRIKDELEMPTAAYNVSGEYAMIKAAAQNGWMDENKIIYES
ITSIKRAGADMILTYFAKDMAKLLK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttccacaggtacggatgagaagattaaggcaagggaagctacaaaatcttgtacgt
gagacaacaattactgcagatgacctgatatgtcctgtttttgtcgatgaaaatattgag
acaccacaggaagtgccctcaatgccgggtacttataaattaccggtcgattatgcagca
gacgaagctaaagaaatctcagatcttggtattccatcgataatgatttttggagttcct
gccagaaaagatgagtctgggagttctgcgtggggtaacaatgaagttgtacagcgtgct
gtcagaaacatcagaaacgatatttcaagcagggatatggctataattaccgatgtctgt
ctttgtgaatacacaacccacggacattgcggtgttgtggactatgataaagaagaaata
ttgaacgaccccactttaccattacttggaaaaactgctgtaagccatgcagaagcaggt
gcagatatggttgctccatccgggatgatggatggcatggtagaatccatcaggtccgaa
cttgataacaataattttgaaaacattcctataatgtcctatgcggctaagtatttctcg
gctttctacggtccttttagagatgccgctgaatcaggttattcctttggcgacaggtca
agttatcagatgaacccttcaaattccaatgaagcaatccgtgaagtggaactggacatt
gatgaaggtgctgacattgtaatggtcaaacccgcactcccgtaccttgacatactatac
cgaatcaaagatgaacttgaaatgccgactgctgcatataatgtaagtggtgaatatgcg
atgataaaagccgctgcacagaacggatggatggacgagaacaaaataatttatgaatca
attacatccattaaacgtgccggagcggatatgatacttacctactttgccaaagatatg
gcaaagcttttgaaataa

DBGET integrated database retrieval system