KEGG   Methanohalobium evestigatum: Metev_0285Help
Entry
Metev_0285        CDS       T01261                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metev_0285
   01230 Biosynthesis of amino acids
    Metev_0285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_0285
   00030 Pentose phosphate pathway
    Metev_0285
   00051 Fructose and mannose metabolism
    Metev_0285
  Energy metabolism
   00680 Methane metabolism
    Metev_0285
Enzymes [BR:mev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Metev_0285
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metev_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(277430..278542)
Genome map
AA seq 370 aa AA seqDB search
METTFSAIKADVGSVAGHHVVPEELEESAISVLEEAKGKDIFDYFVTHCGDDLELIITHD
KGEDSEEVYEIAWNAFLKATEKAKELGLYGAGQDLLSDAFSGNIKGMGPGIAEMEFKERK
SNPVFTFMMDKTEPGAFNLPMYKIFADPFNTAGLVLDPNMHSGFVFEVWDIKESKKINFY
CPNDLYDMLALIGAKSRYVIKRVYPKEDNPKATSQEPAAVISTEKLSHIAGEYVGKDDPV
AVVRGQSGLPAAGEILEPFTHPELVSGWMKGSHNGPLMPVPVEDATPTRFDGPPRAICLG
FQVKDGMLIGPVDSFADPAFDKTREKAHQVSDYMRAHGPFEPHRLPEEEMEYTTLPDVME
KINHRFEDMD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacttttagtgcaattaaagcagatgtaggcagtgtagccggacatcacgtt
gtgcccgaagaacttgaagaaagtgctatatcagttcttgaagaggcaaaaggaaaagat
atatttgattactttgttacccactgcggtgatgaccttgaacttatcataacccatgac
aagggtgaagatagtgaagaggtctatgaaatcgcttggaacgcatttttaaaggctact
gaaaaggcaaaagaactcggattgtatggtgctggacaggaccttttaagtgacgctttt
tcaggaaacatcaaaggtatgggccctggtattgcagaaatggagtttaaagaaagaaaa
agtaatcctgtatttactttcatgatggacaaaactgaaccaggtgcattcaatctgcca
atgtataagatatttgctgacccgttcaacaccgctggcctggtgcttgacccgaatatg
cactctggatttgtttttgaagtgtgggacatcaaagaaagtaaaaaaattaatttctac
tgcccgaatgacctctacgacatgcttgctcttataggtgccaaaagcagatatgtaatc
aaaagagtatatccaaaagaagataatccaaaagcaacttctcaagaacctgctgctgta
atatcaaccgaaaaactatcacatatagcaggagaatatgttggtaaagatgaccctgtt
gcagttgtcagaggtcaatcaggactgcctgctgccggtgaaatacttgaaccgtttact
cacccagaacttgtcagtggatggatgaaaggctctcacaacggaccactgatgcctgta
ccggtggaagatgctacacctacaagatttgatggaccgccaagagctatatgtcttgga
ttccaggtcaaagacggtatgctgataggtccggttgattcatttgcagacccggcattt
gataaaaccagagaaaaagcacatcaagtatctgattatatgcgggcacatggtccattc
gaaccacaccgcctccctgaagaagaaatggaatatactacactacctgatgtcatggaa
aaaatcaatcaccgttttgaagatatggattaa

DBGET integrated database retrieval system