KEGG   Methanohalobium evestigatum: Metev_0285Help
Entry
Metev_0285        CDS       T01261                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev00030  Pentose phosphate pathway
mev00051  Fructose and mannose metabolism
mev00680  Methane metabolism
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
mev01130  Biosynthesis of antibiotics
mev01200  Carbon metabolism
mev01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_0285
   00030 Pentose phosphate pathway
    Metev_0285
   00051 Fructose and mannose metabolism
    Metev_0285
  Energy metabolism
   00680 Methane metabolism
    Metev_0285
Enzymes [BR:mev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Metev_0285
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metev_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADI73213
JGI: Metev_0285
UniProt: D7E6J1
Position
complement(277430..278542)
Genome map
AA seq 370 aa AA seqDB search
METTFSAIKADVGSVAGHHVVPEELEESAISVLEEAKGKDIFDYFVTHCGDDLELIITHD
KGEDSEEVYEIAWNAFLKATEKAKELGLYGAGQDLLSDAFSGNIKGMGPGIAEMEFKERK
SNPVFTFMMDKTEPGAFNLPMYKIFADPFNTAGLVLDPNMHSGFVFEVWDIKESKKINFY
CPNDLYDMLALIGAKSRYVIKRVYPKEDNPKATSQEPAAVISTEKLSHIAGEYVGKDDPV
AVVRGQSGLPAAGEILEPFTHPELVSGWMKGSHNGPLMPVPVEDATPTRFDGPPRAICLG
FQVKDGMLIGPVDSFADPAFDKTREKAHQVSDYMRAHGPFEPHRLPEEEMEYTTLPDVME
KINHRFEDMD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacttttagtgcaattaaagcagatgtaggcagtgtagccggacatcacgtt
gtgcccgaagaacttgaagaaagtgctatatcagttcttgaagaggcaaaaggaaaagat
atatttgattactttgttacccactgcggtgatgaccttgaacttatcataacccatgac
aagggtgaagatagtgaagaggtctatgaaatcgcttggaacgcatttttaaaggctact
gaaaaggcaaaagaactcggattgtatggtgctggacaggaccttttaagtgacgctttt
tcaggaaacatcaaaggtatgggccctggtattgcagaaatggagtttaaagaaagaaaa
agtaatcctgtatttactttcatgatggacaaaactgaaccaggtgcattcaatctgcca
atgtataagatatttgctgacccgttcaacaccgctggcctggtgcttgacccgaatatg
cactctggatttgtttttgaagtgtgggacatcaaagaaagtaaaaaaattaatttctac
tgcccgaatgacctctacgacatgcttgctcttataggtgccaaaagcagatatgtaatc
aaaagagtatatccaaaagaagataatccaaaagcaacttctcaagaacctgctgctgta
atatcaaccgaaaaactatcacatatagcaggagaatatgttggtaaagatgaccctgtt
gcagttgtcagaggtcaatcaggactgcctgctgccggtgaaatacttgaaccgtttact
cacccagaacttgtcagtggatggatgaaaggctctcacaacggaccactgatgcctgta
ccggtggaagatgctacacctacaagatttgatggaccgccaagagctatatgtcttgga
ttccaggtcaaagacggtatgctgataggtccggttgattcatttgcagacccggcattt
gataaaaccagagaaaaagcacatcaagtatctgattatatgcgggcacatggtccattc
gaaccacaccgcctccctgaagaagaaatggaatatactacactacctgatgtcatggaa
aaaatcaatcaccgttttgaagatatggattaa

DBGET integrated database retrieval system