KEGG   Methanohalobium evestigatum: Metev_0291Help
Entry
Metev_0291        CDS       T01261                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mev  Methanohalobium evestigatum
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metev_0291
Enzymes [BR:mev01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Metev_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(283026..283940)
Genome map
AA seq 304 aa AA seqDB search
MAKIGIIVTDNNDWTARALYNAAKERNFNPVFINLENIEVSIGSTIRYSLRENSLSELDA
VVVRDVGAGSIESVSFRFDVLRQLYELGILIVNTPESIQNAANKYYSTYLMAKANLPVPC
TRVVQSVESALKTLDDFRDAIIKPVFGFKGIGIIRIKNYSIIEPDNTTNPKQIEEMVKNE
IDNKGMLYIQEYIPNMGRDIRAYVVDGKVIGAIYRTAPDGKWLNNLSQGGSCQRCSLTPS
QKEISIKAAKTIGTVFAGVDLIEGNNKTMLLEVNGTPSGAGIYKSLGINPADYIMDYIQK
QVRD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatagggataatagtaacagataacaacgactggaccgccagagctctgtac
aatgctgcaaaagaacgaaattttaaccctgtttttataaatctggaaaatatagaagta
tctataggctccacaatccgttattctttaagggaaaacagtttatccgaactggatgct
gtggtagttagggatgtaggggctggttcaatagaaagcgtaagttttcgttttgatgtt
ctgcgacagctgtatgaattagggatacttattgtaaatactcctgaatcaatacaaaac
gcggctaacaaatattattccacataccttatggcaaaagcaaacctgcctgtaccctgt
acaagggttgttcaaagcgttgaaagtgcgttaaaaacactggatgatttcagggatgca
atcataaaacccgtgttcggattcaagggcataggcattataagaattaaaaactattca
attattgaaccagataatacaactaacccaaaacagattgaagaaatggttaaaaatgaa
attgataataaaggaatgctttatatccaggaatatatccccaacatgggaagagacatc
cgtgcttatgtagttgatggcaaggtgattggtgccatatatcgaaccgctcctgatgga
aaatggttaaacaatttaagccagggaggttcttgccaacggtgttcacttacccccagc
cagaaagaaatatccataaaagctgccaaaaccatcggtactgtatttgctggtgttgac
ctgattgaaggtaacaataaaaccatgctacttgaagtcaatggtacaccatcaggtgca
ggaatatacaaatcattgggaattaaccctgctgattatataatggactacattcaaaaa
caagtgagggactga

DBGET integrated database retrieval system