KEGG   Methanohalobium evestigatum: Metev_0436Help
Entry
Metev_0436        CDS       T01261                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
mev01130  Biosynthesis of antibiotics
mev01200  Carbon metabolism
mev01230  Biosynthesis of amino acids
Module
mev_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mev_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_0436
Enzymes [BR:mev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Metev_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA Semialdhyde_dh Sacchrp_dh_NADP NAD_binding_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADI73354
JGI: Metev_0436
UniProt: D7E812
Position
complement(426665..427681)
Genome map
AA seq 338 aa AA seqDB search
MDKVKVGINGYGTIGKRVADAVHQQEDMELIGISKTKPNYEAVMAQRMGYNVYTPSDKTS
KMKDGGIKVAGTVEDMVNEADVIVDATPKGVGEKNKELYEKAGVKAIWQGGEDHEVAGFS
FNADSNYNEAIGRDYTRVVSCNTTALCRLISNIDREYGVKKCRVTLIRRAADPSDIKKGP
INSIVADPVKLPSHHGPDVQSVIPSIDISTMAVKVPNTMMHIHTVNMELKNDCSADDIKN
LLAKNPRMHYLEPGITSTSETMELARDLGRPRNDMWENCIWEDSIDFYEGELYLLQAVHQ
EADVVPENIDAIRAMCELEKDADKSKSKTNKAMGIGTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagtaaaagttggaattaacggatacggaacaataggtaaacgagtggcagat
gcagtacatcagcaggaagacatggaacttataggtatatccaaaacaaaacctaattat
gaagctgtaatggcacagagaatgggttacaatgtttatacaccatcagataaaacatct
aaaatgaaagatggcggtataaaagttgctggtactgttgaagacatggttaacgaggca
gatgtaattgtagatgctactcccaaaggtgtgggggagaagaataaggaactttatgaa
aaagcaggagtgaaagcaatctggcagggtggagaagaccacgaagttgcaggtttttca
ttcaacgctgattccaattataatgaggcaataggtcgtgattacacacgtgtggtttca
tgtaatacaacagctctttgtaggctaatatccaatatagatagggaatatggtgtcaaa
aaatgcagggtcactttgattcgtagagcagctgacccatcggatatcaagaaaggtcct
atcaattcaattgtagcagaccctgtaaaactcccatctcatcatggtcctgatgtccaa
tcagtcataccaagtattgatatctctacaatggctgttaaagtaccaaataccatgatg
cacattcatactgttaatatggagttgaaaaatgactgtagtgcagacgacatcaaaaac
ctgcttgcaaaaaatccaagaatgcattaccttgaacctggtataacctcaacatcagaa
actatggaacttgcaagagacctcggtcgtccaagaaatgatatgtgggaaaactgcatc
tgggaagattccatcgatttctatgaaggtgaactctatctattacaggcagtccaccaa
gaagcggatgttgttccagaaaatattgatgcgatacgggctatgtgtgaacttgagaag
gatgctgacaaatccaaatccaaaacaaataaagcaatgggaatcggaaccaaataa

DBGET integrated database retrieval system