KEGG   Methanohalobium evestigatum: Metev_0523Help
Entry
Metev_0523        CDS       T01261                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metev_0523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_0523
   00620 Pyruvate metabolism
    Metev_0523
   00640 Propanoate metabolism
    Metev_0523
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metev_0523
   00680 Methane metabolism
    Metev_0523
Enzymes [BR:mev01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metev_0523
Lipid biosynthesis proteins [BR:mev01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metev_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
519232..521193
Genome map
AA seq 653 aa AA seqDB search
MGAWIMEETIESKLEEYELINPPEDFVKQANINDPEVYKRAEDNPEKFWEELAEHIDWFE
KWKRVLGWEPPHAKWFVGGKLNASYNCIDRHINKRGEKTAILWEGEKGDIRKYTYNELLE
ATSRFANALKNQGVEKGDIVTIYMPMIPEAVIAMLACARIGAPHSVVFAGFSADALADRI
NNAESKYVITTDGYYRRGKILEHKNKTDEGISKAETVEKVIVVNHLDNEIEIKPGRDVWW
HEIIESADSTCEPEKMDSEDMLFLMYTSGTTGSPKGIVHTTGGYMVGTHVTANWVFDLKE
DDIYWCSADVGWITGHSYIVYGPLSNGSTIFMYEGAPDYPDKDRFWEMIEKHKITIFYTA
PTAVRAFMKWGSEWPEKHDLSSLRLLGTVGEPINPDPWWWYYKNIGYEKCPIVDTWWQTE
TGMILITPLPGITPMKPGSPTNPFPGIKASVLDDEGNKIEPGHGGYLAIERPWPSMIRTV
YGDEERFINTYWSKWGPDKYMTEDAARLDNDNYFWILGRVDDVINVAGHRLGTMELESAL
ESHPDVVEAAVEGIKDEIKGEAVFGYVILSSGSKEDEKLKQELRDKIVKDIGPIAKPKGI
VFTDDLPKTRSGKIMRRILKAITNNKDEGDTSTLQNPEIVDELKRKVKELDVN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgtggataatggaagaaacgattgaatcaaaacttgaagaatatgaactaata
aatccccctgaagattttgtaaaacaagccaatataaatgaccctgaggtatataaaaga
gctgaagataacccagaaaaattctgggaagaacttgcagagcatatcgattggttcgaa
aaatggaaacgtgtccttggatgggaacctccacatgcaaaatggtttgttggtggaaaa
ctcaatgcatcgtataattgcattgaccggcatataaacaaacgtggtgaaaagaccgct
atcctctgggaaggtgaaaaaggagacatccgcaaatatacatataatgaactcttagaa
gccacttcaagatttgcaaatgcactgaaaaatcagggtgttgaaaaaggagatattgtc
accatatatatgcccatgatacctgaagcggttatagccatgcttgcctgtgccagaatc
ggtgctcctcatagtgtagtttttgccggtttttcggctgatgctcttgcagaccgaata
aacaatgcagaaagtaaatacgttatcacaacagatggttattatagacgtggaaagatt
ctggaacacaaaaacaaaaccgatgaagggattagtaaagcagaaactgtagaaaaagtc
attgttgtcaatcatcttgataatgaaatagagataaaacccggaagagatgtttggtgg
catgaaataattgaatctgcagattctacctgtgaacccgaaaaaatggattctgaagat
atgctgtttttaatgtacacaagcggtactaccggtagtccgaaaggtattgtccataca
accggtgggtatatggttggtactcatgttacagcaaactgggtttttgatttaaaagag
gatgacatatactggtgttcagcagatgttggatggattaccggtcactcgtatattgtt
tatggtcctctttcaaatggctcgaccatattcatgtatgaaggtgcaccggattatccg
gataaagaccgattctgggaaatgattgaaaaacacaaaattacaatattttacacagca
ccaaccgcagtccgagcctttatgaaatgggggtctgaatggcctgagaaacatgacctt
tcatcattaagactgctcggaaccgtgggtgaaccaattaaccctgacccatggtggtgg
tactacaaaaacattggatatgaaaaatgcccgattgttgatacatggtggcagaccgaa
accggtatgatattgataacaccactacccggaataacacccatgaaaccaggtagtccg
acaaacccgttccctggtataaaggcttcagttcttgacgatgaaggcaataaaatagaa
ccgggtcatggtggatatcttgcaatagaaagaccttggcccagtatgattcgcacggtt
tatggggatgaagagcggtttatcaacacctactggagcaaatggggtcctgataaatat
atgaccgaagacgctgcccggttggataatgacaattatttctggattctgggtcgtgta
gatgatgttatcaatgtcgctggacatcgtcttggtactatggaattggaaagtgcgttg
gaatcacatcctgatgttgttgaagctgccgttgaaggtataaaagatgaaataaaagga
gaagcagtttttggttatgtcatattgagttcggggtcaaaagaagatgagaaactcaag
caggaattaagggataaaattgttaaagacatagggcctattgcaaaaccaaaaggaatt
gtatttacggacgaccttccgaaaacaagaagcggtaaaataatgagaagaattttgaaa
gccattacaaacaataaagatgaaggcgacacttctacccttcaaaaccctgaaatcgta
gatgagcttaaaagaaaagttaaagaattagatgtgaattga

DBGET integrated database retrieval system