KEGG   Methanohalobium evestigatum: Metev_0728Help
Entry
Metev_0728        CDS       T01261                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01130  Biosynthesis of antibiotics
mev01230  Biosynthesis of amino acids
Module
mev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0728
Enzymes [BR:mev01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Metev_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth QRPTase_C PcrB Trp_syntA IMPDH ThiG DUF61
Motif
Other DBs
NCBI-ProteinID: ADI73629
JGI: Metev_0728
UniProt: D7E705
Position
695189..695983
Genome map
AA seq 264 aa AA seqDB search
MHHIIGNIIDSTKKRVDDLKKNNSYSGIDKTDIRNIETIINETKKYYKVPVIAEIKPASP
STFYREISPPDAASIAKEMEKAGAAAISVLTEPDYFHGSIDNLDYVRNESTLPVLRKDFI
IDETQMDEQQTDLILLIASVLGNQLENFVSTAQSKGIQPLVEVHDRNELEKALQTSAKII
GINNRNLNTFEIDLQTTYDLAPIIKQYDIENNTNHIVISESGIDSQEDVKQLINSGADAL
LIGSSIIKSDDIYSKTKELVESLK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcatataattggaaatatcatagattctactaaaaaacgggttgatgatttgaaa
aaaaataactcgtattctggaatagacaaaaccgatattcgaaacatagaaacaatcatc
aatgaaacgaaaaaatattacaaagttccggttatcgccgaaattaaacctgcatcacca
agcacattttatcgggagatatcaccgccagacgcggcatcaattgcaaaggaaatggaa
aaagccggtgctgctgcaatttctgtattgacagaaccggactactttcacggctcaatt
gacaatctggactatgtaagaaatgaatcaacacttccagtactccgcaaggatttcata
atcgatgaaactcagatggatgaacaacaaaccgatcttatacttttaattgcttcagtt
cttggaaaccagctggaaaattttgtatccacagcgcaatcaaaagggatacaacctctt
gtggaagtacatgacagaaacgaacttgaaaaagccctccagacctctgcaaaaataatc
ggaatcaacaaccgcaatctcaacacatttgaaattgacctgcaaacaacatacgacctt
gctccaattataaaacaatatgacatagaaaacaacaccaatcatatcgtaataagtgag
agcgggatagattctcaagaggatgttaaacaattaattaactctggagcggatgcattg
ctaattggctcttccatcatcaaaagtgatgatatatacagcaaaacaaaagaactggtg
gaatcactaaaataa

DBGET integrated database retrieval system