KEGG   Methanohalobium evestigatum: Metev_0729Help
Entry
Metev_0729        CDS       T01261                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_0729
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0729
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0729
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
696011..697207
Genome map
AA seq 398 aa AA seqDB search
MTSKATYGKYGGQYVSEMLLPAISELERKYEYYKNNPDFLKDLHYYLNDFAGRETPLYFA
RNLSEKYGIKIYLKREDLLHGGAHKINNTLGQALLARYMGKHRIVAETGAGQHGTATAMA
GAALGLDTVVYMGEKDVERQKTNVYRMEMLGAKVHPVSAGSKTLKDAINEALRDWVSNVD
STHYLIGSVVGPHPYPMIVRDFQCVIGNEVKKQIIEKEGKYPDSIVACTGGGSNAMGTFH
PFVDDTGVKLISVEAGGESMKSTSKAALHSASLCVGEEGILHGAKTRILQDKYGQILESH
SISAGLDYSGVGPELSYLKDSERLNTAVASDKEAIDAFHELCHLEGIIPALESSHAIAHV
LKKAKTGELGNIVVINLSGRGDKDLDTVIKSSKGEGNI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtaaagctacatatggaaaatacggcgggcagtacgtttccgaaatgctgtta
cccgctatatcagaacttgaaagaaaatatgagtattataaaaacaaccctgattttttg
aaggacttgcattactaccttaatgattttgcaggtcgtgagaccccgctttattttgcc
agaaacttaagcgaaaaatacggaataaaaatctatctcaaacgtgaagatctgctacat
ggtggcgctcataaaataaacaatacacttggacaggcactgcttgcaagatacatggga
aaacaccgcatagtagctgaaaccggtgcaggccaacacggcacagcaactgccatggcg
ggagctgcattagggcttgacacagtagtatatatgggagaaaaggatgtggaaaggcaa
aaaacgaatgtctacaggatggaaatgctgggtgcaaaagtacatcctgttagtgccggg
tctaaaaccctgaaagatgctattaatgaggctctcagggattgggtgagtaatgtcgat
agcactcactaccttatcgggtcggtagttggtccccatccgtaccccatgattgtcagg
gatttccagtgtgtaatcggtaatgaagtaaaaaaacaaataatagaaaaagaaggaaaa
tatcccgattcaattgtcgcctgtaccggaggcggaagcaacgcaatgggtacattccac
ccatttgtcgatgatacaggtgtaaaactcatatctgttgaagccggtggagaaagtatg
aaatccacaagtaaagcggctcttcattccgcatcactatgtgttggtgaagaaggaatt
ttacacggtgctaaaacccggatattacaggacaaatacggacagatactggaatctcat
tctatttctgcaggtctggattattcaggagtgggtcctgaactttcttacttgaaagat
tcagaaaggcttaacactgctgttgccagtgataaagaagcaatcgatgctttccacgaa
ttgtgtcatctggaaggaattattcctgcccttgaatcatcccatgccattgctcatgta
ctgaaaaaagcaaaaacaggtgaactgggaaacatagtggtaatcaatctgtcaggcaga
ggagataaagaccttgacactgtaatcaaaagcagtaaaggagaaggaaatatatga

DBGET integrated database retrieval system