KEGG   Methanohalobium evestigatum: Metev_0730Help
Entry
Metev_0730        CDS       T01261                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00260  Glycine, serine and threonine metabolism
mev00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01130  Biosynthesis of antibiotics
mev01230  Biosynthesis of amino acids
Module
mev_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0730
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth IGPS NanE PcrB Pneumo_ncap NMO
Motif
Other DBs
NCBI-ProteinID: ADI73631
JGI: Metev_0730
UniProt: D7E707
Position
697204..698013
Genome map
AA seq 269 aa AA seqDB search
MKISEKFDNLDENEAALISYVCAGDPSPDATKNIVSSLVRGGADIIELGLPFSDPMADGP
SIQAASKRSIEAGMNPDLYFELVSSISDKFNIPFVCMTYYNLIYKRGTEKFVQDCAQSGI
SGVIVPDLPVEESDELANACQKNDVDLILIITPVTGKERTKKITEKSSGFLYIVSRLGVT
GARSDIAENTGQLLKMVNSSIPKAVGFGISTPEQVKNVVLSGANGVIVGSAFVNIIASND
DIYNRTEKFTAELKNNCYINYSKSWSTNH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcagaaaaatttgataatttggatgaaaatgaagcagctcttatttcttat
gtttgtgcaggagatccgtcacctgatgctacaaaaaatattgtcagctcacttgttaga
ggcggagcagatatcattgagctgggtttaccattttcagaccctatggccgatggaccc
tctatacaggctgcttcaaaaagatccattgaagctggaatgaaccctgatttgtatttt
gagctggtttcatccatttctgacaagttcaatataccatttgtttgtatgacctattac
aaccttatatacaaaaggggtacagaaaaatttgtgcaggactgcgcacaatcaggtata
agtggtgtcatagtacccgaccttccagttgaagagtcagatgaacttgcaaatgcctgt
caaaaaaatgacgtggatttaatccttataattacacctgtcacaggcaaggaaaggaca
aaaaagattactgaaaaatcttcaggttttctttatattgtatccagactgggagttacc
ggtgcacgcagtgatatagccgaaaatactggacaacttttaaaaatggttaattcatcc
atcccgaaagcagttggatttggtatatctacacccgaacaggtcaaaaatgttgtttta
tcaggtgcaaacggtgtaattgtgggatcggcatttgtaaatataattgcatcaaatgat
gacatatacaacaggacagaaaaatttacagcagaattgaaaaataactgctacataaat
tattcaaaaagctggtctacaaaccattga

DBGET integrated database retrieval system