KEGG   Methanohalobium evestigatum: Metev_0730Help
Entry
Metev_0730        CDS       T01261                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_0730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metev_0730
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metev_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
697204..698013
Genome map
AA seq 269 aa AA seqDB search
MKISEKFDNLDENEAALISYVCAGDPSPDATKNIVSSLVRGGADIIELGLPFSDPMADGP
SIQAASKRSIEAGMNPDLYFELVSSISDKFNIPFVCMTYYNLIYKRGTEKFVQDCAQSGI
SGVIVPDLPVEESDELANACQKNDVDLILIITPVTGKERTKKITEKSSGFLYIVSRLGVT
GARSDIAENTGQLLKMVNSSIPKAVGFGISTPEQVKNVVLSGANGVIVGSAFVNIIASND
DIYNRTEKFTAELKNNCYINYSKSWSTNH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcagaaaaatttgataatttggatgaaaatgaagcagctcttatttcttat
gtttgtgcaggagatccgtcacctgatgctacaaaaaatattgtcagctcacttgttaga
ggcggagcagatatcattgagctgggtttaccattttcagaccctatggccgatggaccc
tctatacaggctgcttcaaaaagatccattgaagctggaatgaaccctgatttgtatttt
gagctggtttcatccatttctgacaagttcaatataccatttgtttgtatgacctattac
aaccttatatacaaaaggggtacagaaaaatttgtgcaggactgcgcacaatcaggtata
agtggtgtcatagtacccgaccttccagttgaagagtcagatgaacttgcaaatgcctgt
caaaaaaatgacgtggatttaatccttataattacacctgtcacaggcaaggaaaggaca
aaaaagattactgaaaaatcttcaggttttctttatattgtatccagactgggagttacc
ggtgcacgcagtgatatagccgaaaatactggacaacttttaaaaatggttaattcatcc
atcccgaaagcagttggatttggtatatctacacccgaacaggtcaaaaatgttgtttta
tcaggtgcaaacggtgtaattgtgggatcggcatttgtaaatataattgcatcaaatgat
gacatatacaacaggacagaaaaatttacagcagaattgaaaaataactgctacataaat
tattcaaaaagctggtctacaaaccattga

DBGET integrated database retrieval system