KEGG   Methanohalobium evestigatum: Metev_0742Help
Entry
Metev_0742        CDS       T01261                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mev  Methanohalobium evestigatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metev_0742
Enzymes [BR:mev01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Metev_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
704634..705695
Genome map
AA seq 353 aa AA seqDB search
MEHIQKLLEKLSNAHGISGSENNIRNIMEEEIRPYVDDIRTDKNGNLIATKKGSGPTIML
AAHMDEIGLMVKYIDDNGFIRFVKVGGWFDQTLYNQRVVIDTENGPIKGVIGAKPPHVMS
DEDKKKPIKAEDMFIDVGAKDKEDAENLGVQVGSTISLDRDFEPLANGFMTGKAFDNRAG
VAVTIEIMKQLSEMDVDIKPTIYAVGTVQEEVGLKGARTSAFGLNPDAAIAIDTTIPGDH
PGIEKKDSALEIGEGCVITVMDAGGRGLIADKNIVKWLKETGNENDIPYQMDVSDGGTTD
ATAIHITREGIPSSTISIATRYIHSPVELLSIDDMKSAADLVTKAILNTEKYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaacatatacaaaaactgcttgaaaaattgtcaaatgctcatggaatatcgggatct
gaaaacaatatcagaaatataatggaagaagaaatcagaccctatgtagacgacatcaga
accgacaaaaacggaaaccttatagccacaaaaaagggcagtggacctaccataatgctg
gctgctcatatggacgaaattggattgatggtcaaatacatcgatgacaacgggtttata
agatttgtaaaagtcggtggatggtttgatcaaacactttacaatcagcgcgttgtaata
gacactgaaaacggtcctataaaaggagtcatcggtgccaaaccaccacatgtgatgagc
gacgaggataagaagaaaccgataaaagcagaagatatgtttatagacgttggtgccaag
gataaagaagacgcagaaaatcttggtgtacaggtagggtctaccatatctcttgacagg
gattttgaaccccttgcaaatggatttatgaccggaaaagcctttgataacagagcgggt
gttgccgtaaccattgaaataatgaaacaactttcagaaatggatgttgatataaagcct
actatatatgctgtgggaactgtacaggaagaagtcggattaaaaggagctcgtacatca
gcattcggactgaatccagacgctgccatagctattgatactactatacccggtgaccat
cccggtattgagaaaaaagattcagcccttgaaataggagaagggtgtgttattactgta
atggacgctggtggcagaggattaatcgctgacaaaaatattgttaaatggctaaaggaa
acaggaaatgaaaacgacataccatatcaaatggatgttagtgatggcggtacaactgat
gcaactgctatacatattacaagagaaggtataccttcaagcaccatcagtattgcaacc
agatatattcactcacctgttgaactcctgagtatagacgacatgaagtctgccgcagac
cttgtaaccaaagcaattttaaatactgaaaaatatctctga

DBGET integrated database retrieval system