KEGG   Methanohalobium evestigatum: Metev_0742Help
Entry
Metev_0742        CDS       T01261                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mev  Methanohalobium evestigatum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
704634..705695
Genome map
AA seq 353 aa AA seqDB search
MEHIQKLLEKLSNAHGISGSENNIRNIMEEEIRPYVDDIRTDKNGNLIATKKGSGPTIML
AAHMDEIGLMVKYIDDNGFIRFVKVGGWFDQTLYNQRVVIDTENGPIKGVIGAKPPHVMS
DEDKKKPIKAEDMFIDVGAKDKEDAENLGVQVGSTISLDRDFEPLANGFMTGKAFDNRAG
VAVTIEIMKQLSEMDVDIKPTIYAVGTVQEEVGLKGARTSAFGLNPDAAIAIDTTIPGDH
PGIEKKDSALEIGEGCVITVMDAGGRGLIADKNIVKWLKETGNENDIPYQMDVSDGGTTD
ATAIHITREGIPSSTISIATRYIHSPVELLSIDDMKSAADLVTKAILNTEKYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaacatatacaaaaactgcttgaaaaattgtcaaatgctcatggaatatcgggatct
gaaaacaatatcagaaatataatggaagaagaaatcagaccctatgtagacgacatcaga
accgacaaaaacggaaaccttatagccacaaaaaagggcagtggacctaccataatgctg
gctgctcatatggacgaaattggattgatggtcaaatacatcgatgacaacgggtttata
agatttgtaaaagtcggtggatggtttgatcaaacactttacaatcagcgcgttgtaata
gacactgaaaacggtcctataaaaggagtcatcggtgccaaaccaccacatgtgatgagc
gacgaggataagaagaaaccgataaaagcagaagatatgtttatagacgttggtgccaag
gataaagaagacgcagaaaatcttggtgtacaggtagggtctaccatatctcttgacagg
gattttgaaccccttgcaaatggatttatgaccggaaaagcctttgataacagagcgggt
gttgccgtaaccattgaaataatgaaacaactttcagaaatggatgttgatataaagcct
actatatatgctgtgggaactgtacaggaagaagtcggattaaaaggagctcgtacatca
gcattcggactgaatccagacgctgccatagctattgatactactatacccggtgaccat
cccggtattgagaaaaaagattcagcccttgaaataggagaagggtgtgttattactgta
atggacgctggtggcagaggattaatcgctgacaaaaatattgttaaatggctaaaggaa
acaggaaatgaaaacgacataccatatcaaatggatgttagtgatggcggtacaactgat
gcaactgctatacatattacaagagaaggtataccttcaagcaccatcagtattgcaacc
agatatattcactcacctgttgaactcctgagtatagacgacatgaagtctgccgcagac
cttgtaaccaaagcaattttaaatactgaaaaatatctctga

DBGET integrated database retrieval system