KEGG   Methanohalobium evestigatum: Metev_0862Help
Entry
Metev_0862        CDS       T01261                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00330  Arginine and proline metabolism
mev00332  Carbapenem biosynthesis
mev01100  Metabolic pathways
mev01130  Biosynthesis of antibiotics
mev01230  Biosynthesis of amino acids
Module
mev_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metev_0862
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Metev_0862
Enzymes [BR:mev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Metev_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADI73760
JGI: Metev_0862
UniProt: D7E8T9
Position
816408..817532
Genome map
AA seq 374 aa AA seqDB search
MVNRKKLFSDVEKVVVKIGTSSISNDDGTLNHDLMDRISYQVSELHNMGKEVIIVSSGSI
GVGVGQLNLGSKPREIPVRQAAAAVGQSVLMQEWIKTFQKYNLNVAQILITYESFSNRLT
YLNLRNSISTLLNYGVIPIINENDSTSVHEIEATFGDNDKLSAMVASKMEADLLIMLSDI
DGLYDKNPKRNHNARLMKTVEAITPEIESYGGDPTSLKGVGGMRTKIEAAKICSMSGCYM
VIANSNIDYVVSRVFNGEEIGTLFLANQDVHKNRIRWIILAKSSGTIDIDSGAKKAIENH
MSLLPSGVVDITGEFDRGDIVELKCDGEVFAKGITDYTSDELKQIKGKHTDMIADILGYK
NYDHVIKKENIGLF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttggttaacagaaaaaaattattcagtgatgttgagaaggttgtagtaaaaattggtaca
tcatccataagtaatgatgacggtacgctaaaccatgacctcatggacagaattagctat
caggtttctgaactacacaatatgggaaaagaggttataattgttagttcagggtctata
ggggtaggtgtaggccagcttaatcttggttccaaaccgcgggaaatccctgttcgccag
gctgctgctgctgtaggacagagtgtccttatgcaggagtggataaaaacttttcaaaaa
tacaatctgaatgttgcccagattttaataacctatgaatccttttctaaccgtcttaca
tatctgaacttgagaaacagcatctctacattgctgaattatggtgttatacccatcatc
aacgaaaacgacagcacttctgtacatgaaattgaggctacctttggagacaacgacaaa
ttatctgccatggttgccagtaaaatggaagccgatttattgattatgctttcagacatc
gacggcttatatgataaaaatccgaaaagaaatcataacgccagattgatgaaaactgtg
gaagcgattacacctgaaattgaaagttatggcggagaccctaccagtttgaagggtgta
ggtggcatgcggaccaaaatcgaagccgctaaaatctgcagtatgtccggttgctatatg
gttatcgcaaatagcaatatcgattatgttgtatcaagagtatttaatggtgaagagatt
ggaacactgtttcttgccaatcaggatgtgcataaaaacaggattagatggataattcta
gctaaatcctcaggaacgattgatattgattccggtgcaaaaaaagcgattgaaaatcac
atgagccttctgccttcaggagttgtagatattactggagaatttgacagaggagatatt
gtagaacttaaatgcgatggagaagtattcgcaaagggcataacagactacacatcagat
gaactaaaacagattaaaggcaaacatacagacatgattgcagatattcttgggtacaaa
aactacgaccatgtaatcaaaaaagaaaacattggtcttttctaa

DBGET integrated database retrieval system