KEGG   Methanohalobium evestigatum: Metev_1413Help
Entry
Metev_1413        CDS       T01261                                 

Definition
(GenBank) PfkB domain protein
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mev  Methanohalobium evestigatum
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Metev_1413
   00240 Pyrimidine metabolism
    Metev_1413
Enzymes [BR:mev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Metev_1413
    2.7.1.213  cytidine kinase
     Metev_1413
    2.7.1.-  
     Metev_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1407175..1408071)
Genome map
AA seq 298 aa AA seqDB search
MDNTISIVGHTALDHLFNVEKIAGPNESFPILDYEISYGGGAANIAATIATLGGKCQLIS
GVGNDFKSSGYEDYLTSTGVDLSHLYRMEDEKSTKAFVFTDKNHNQCTYFHWGPSARLKK
TDPPSLDFVHLATSEPVFNSKVAQKAGFVSFDPGQDLVTYTSELLETILYNTNIMFANKH
EIKRVCDMINQPFDKLKDMLDVVVVTYDEEGSRIYTDDIDYWIPAIPVNAVDPTGAGDGY
RAGFLLGYIQRYPLNECGKIGSTVASFIVEKAGCQTNLPVWNDVEKRCKYYYDLNLSD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggataatacaatatcaatcgtgggtcatacagctcttgatcacctatttaatgtagaa
aaaatagcaggaccaaatgagtcctttcctatacttgattatgaaatatcctatggggga
ggtgctgcaaatattgcagctacaattgcaacacttggtggaaaatgtcagttaatatct
ggagttggtaatgactttaaaagcagtggatatgaagattacctgacatcaacaggtgtg
gatttatcccacctttacagaatggaagatgaaaaaagtacaaaagcatttgtatttact
gataagaatcataaccagtgtacttattttcattggggaccatcagcacgtttaaaaaaa
acagatcccccatcacttgattttgttcatcttgctacatctgaaccagtattcaattct
aaagtggctcaaaaggctggatttgtatcctttgatcctggtcaggatttggtaacctat
acctctgaacttcttgagacaatcctttacaataccaatattatgtttgcaaacaaacat
gaaatcaaaagggtatgtgacatgataaaccagccttttgataaacttaaagatatgctt
gatgttgttgtagtgacctacgatgaggaaggtagtagaatctatacagatgatattgat
tactggattcctgcgatccctgttaatgcagtagacccaacaggtgccggtgatgggtat
cgtgcaggatttttacttggatatatccagagatatccgcttaatgaatgtggaaaaata
ggttcaacagtggcatcatttatagtagaaaaagctggttgccagacaaatctacctgtc
tggaacgatgttgaaaaacggtgcaaatactattatgatttaaatctttcagattaa

DBGET integrated database retrieval system