KEGG   Methanohalobium evestigatum: Metev_1679Help
Entry
Metev_1679        CDS       T01261                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00240  Pyrimidine metabolism
mev00250  Alanine, aspartate and glutamate metabolism
mev01100  Metabolic pathways
Module
mev_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metev_1679
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metev_1679
Enzymes [BR:mev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Metev_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADI74518
JGI: Metev_1679
UniProt: D7EB01
Position
1680149..1681075
Genome map
AA seq 308 aa AA seqDB search
MRFKDLDIISMKDFSRDMIDHILDTAEKLEPIAKNEEKSDILNGKILAVLFFEPSTRTRM
SFETAIKRLNGDVLSLGAVDASSITKGENLADTIRVIEGYADGIVLRHPKEGSAKMAAEM
TTIPVINAGDGAGHHPTQTFLDLYTMRRESRLDGVKIAIAGDLKYGRTVHSLCYALSHYN
AEITLVSPKDLRMPREIIRDLKNRGIEVKQTDSMEDAIQDVDVLYVTRIQKERFPDPAEY
QRVSTSLQVTNELLKNANPDLKIMHPLPRVNEIDSGVDFTSHACYFKQSFYGVPVRMALL
SLIMGCVE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaagaccttgacataatctcaatgaaagacttctcaagggatatgatagac
catatccttgatactgcagaaaaacttgaacccatcgcaaaaaatgaagaaaaatccgac
attctgaatggaaaaattctggcagtcctcttttttgaacccagtacaagaacaaggatg
tcctttgaaaccgccataaaaaggcttaacggtgatgtattaagccttggtgctgttgat
gcaagctcaattacaaaaggagaaaatcttgcagatactatacgtgtgatagagggatat
gctgacggaatagtactgagacatcctaaagaaggttctgcaaaaatggcggctgaaatg
accactataccggtcataaatgcaggtgatggtgcgggacatcaccccacccagacattt
cttgatttatataccatgcgaagagagagccggctggatggagtcaaaatagctattgca
ggagacctaaaatatggacgcactgtccattccctctgttatgcattatctcattacaac
gccgaaataacactggtatctccaaaagatctcagaatgccccgtgaaataataagagat
ctcaaaaaccgaggtatagaagtaaagcagactgattctatggaagatgctatacaggat
gtggatgtcctctatgtgacaagaatacaaaaggagcgcttccctgaccctgcagaatat
cagagagtatcaaccagtttacaggttacaaatgaactccttaagaatgcaaatcccgac
ttaaaaatcatgcatccacttcccagagtaaatgaaattgattctggtgtggactttaca
tctcacgcatgttatttcaaacaatcattttacggagttcctgtcaggatggcgttactg
tcgcttataatggggtgtgtagaatga

DBGET integrated database retrieval system