KEGG   Methanohalobium evestigatum: Metev_1679Help
Entry
Metev_1679        CDS       T01261                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mev  Methanohalobium evestigatum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mev00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mev00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1680149..1681075
Genome map
AA seq 308 aa AA seqDB search
MRFKDLDIISMKDFSRDMIDHILDTAEKLEPIAKNEEKSDILNGKILAVLFFEPSTRTRM
SFETAIKRLNGDVLSLGAVDASSITKGENLADTIRVIEGYADGIVLRHPKEGSAKMAAEM
TTIPVINAGDGAGHHPTQTFLDLYTMRRESRLDGVKIAIAGDLKYGRTVHSLCYALSHYN
AEITLVSPKDLRMPREIIRDLKNRGIEVKQTDSMEDAIQDVDVLYVTRIQKERFPDPAEY
QRVSTSLQVTNELLKNANPDLKIMHPLPRVNEIDSGVDFTSHACYFKQSFYGVPVRMALL
SLIMGCVE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaagaccttgacataatctcaatgaaagacttctcaagggatatgatagac
catatccttgatactgcagaaaaacttgaacccatcgcaaaaaatgaagaaaaatccgac
attctgaatggaaaaattctggcagtcctcttttttgaacccagtacaagaacaaggatg
tcctttgaaaccgccataaaaaggcttaacggtgatgtattaagccttggtgctgttgat
gcaagctcaattacaaaaggagaaaatcttgcagatactatacgtgtgatagagggatat
gctgacggaatagtactgagacatcctaaagaaggttctgcaaaaatggcggctgaaatg
accactataccggtcataaatgcaggtgatggtgcgggacatcaccccacccagacattt
cttgatttatataccatgcgaagagagagccggctggatggagtcaaaatagctattgca
ggagacctaaaatatggacgcactgtccattccctctgttatgcattatctcattacaac
gccgaaataacactggtatctccaaaagatctcagaatgccccgtgaaataataagagat
ctcaaaaaccgaggtatagaagtaaagcagactgattctatggaagatgctatacaggat
gtggatgtcctctatgtgacaagaatacaaaaggagcgcttccctgaccctgcagaatat
cagagagtatcaaccagtttacaggttacaaatgaactccttaagaatgcaaatcccgac
ttaaaaatcatgcatccacttcccagagtaaatgaaattgattctggtgtggactttaca
tctcacgcatgttatttcaaacaatcattttacggagttcctgtcaggatggcgttactg
tcgcttataatggggtgtgtagaatga

DBGET integrated database retrieval system